DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4645 and Yipf1

DIOPT Version :9

Sequence 1:NP_001285171.1 Gene:CG4645 / 32244 FlyBaseID:FBgn0030435 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_006238566.1 Gene:Yipf1 / 298312 RGDID:735206 Length:355 Species:Rattus norvegicus


Alignment Length:339 Identity:115/339 - (33%)
Similarity:163/339 - (48%) Gaps:76/339 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ADDLLQFRDYSGGA--------PAQINVNSPT----HGGSGGSGGGSAGSGGSVGGGGANAQRQR 58
            |.|.|||.::..||        ...||:..|:    |         .....||:|       |:.
  Rat     3 AVDDLQFEEFGDGATLLAANPDATTINIEDPSVSFKH---------QPRPPGSLG-------REE 51

  Fly    59 GDPLADLIYDMTSSAQGFSGAASSGGSQPQNSSLDGSAGGGGGGAKLSLFTIEYYQQFFNVDTYM 123
            .:.|..     |:.:......|....|.|                   .:|.||||.||:||||.
  Rat    52 DEELLG-----TNDSDETELLAGQKKSSP-------------------FWTFEYYQTFFDVDTYQ 92

  Fly   124 VLERIANSMIPKRASGNYLRMNIGENPDLYGPFWITVTLIFSIAISGNIASYLQQATDAYKWHY- 187
            |.:||..|::|.... |::|:.|..||||||||||..||:|:||||||::::|....:. .:|| 
  Rat    93 VFDRIKGSLLPVPGK-NFVRLYIRSNPDLYGPFWICATLVFAIAISGNLSNFLIHLGEK-TYHYV 155

  Fly   188 -NFHLVSYAATSIFLYANILPAVLWALFKYSLKPVDSADAVETDSASYMPSLLSLMCIYGYSLAI 251
             .|..||.|||.|:.||.::|..||....:....|       .:..||  |.|.::|:|||||.|
  Rat   156 PEFQKVSIAATVIYAYAWLVPLALWGFLLWRNSKV-------MNIVSY--SFLEIVCVYGYSLFI 211

  Fly   252 YIPVSILWVINISLLQWLLVITAALLSGTVLIAVLTPALR--NSQFSLFLIVGILSAHVVLAAGF 314
            |||.::||:|...:::|:||..|..:||:||.....||:|  |.:.:|..||.|:..||:|:.|.
  Rat   212 YIPTAVLWIIPQRVIRWVLVTIALGISGSVLAMTFWPAVREDNRRVALATIVTIMLLHVLLSVGC 276

  Fly   315 L---------LYFF 319
            |         ||.|
  Rat   277 LVCSYGTHLVLYLF 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4645NP_001285171.1 Yip1 149..310 CDD:282716 70/164 (43%)
Yipf1XP_006238566.1 Yip1 100..277 CDD:398520 77/187 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352442
Domainoid 1 1.000 139 1.000 Domainoid score I4661
eggNOG 1 0.900 - - E1_KOG3114
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5898
Inparanoid 1 1.050 177 1.000 Inparanoid score I3931
OMA 1 1.010 - - QHG54497
OrthoDB 1 1.010 - - D1425332at2759
OrthoFinder 1 1.000 - - FOG0001880
OrthoInspector 1 1.000 - - otm46158
orthoMCL 1 0.900 - - OOG6_101326
Panther 1 1.100 - - O PTHR12822
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1411
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.770

Return to query results.
Submit another query.