DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4645 and Yipf3

DIOPT Version :9

Sequence 1:NP_001285171.1 Gene:CG4645 / 32244 FlyBaseID:FBgn0030435 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_036016527.1 Gene:Yipf3 / 28064 MGIID:106280 Length:367 Species:Mus musculus


Alignment Length:359 Identity:91/359 - (25%)
Similarity:130/359 - (36%) Gaps:100/359 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 APAQ--INVNSPTHGG--SGGSGGGSA---------GSGGSVGGGGANAQRQRGDPLADLIYDMT 70
            |||.  .|...|..||  ....|||||         .||.|....|...||.|.:.:     |..
Mouse     6 APASGVRNGAGPEWGGFEENIQGGGSAVIDMENMDDTSGSSFEDMGELHQRLREEEV-----DAD 65

  Fly    71 SSA-----------QGFSGAASSGGSQPQNSSLDGSAGGGGGGAKLSLF-TIEYYQQFFNVDTYM 123
            ::|           :||.|..|.     |.:.....||........||: .|:..:.:|:|:...
Mouse    66 AAAAEEEDGEFLGMKGFKGQLSR-----QVADQMWQAGKRQASRAFSLYANIDILRPYFDVEPAQ 125

  Fly   124 VLERIANSMIPKRASGNYLRMNIGENPDLYGPFWITVTLIFSIAISGNIAS--YLQQATDAYKWH 186
            |..|:..||||.:.. |:.:...||   ||||..:..||: :|.:.|...|  .:::.|      
Mouse   126 VRSRLLESMIPIKMV-NFPQKVAGE---LYGPLMLVFTLV-AILLHGMKTSDTIIREGT------ 179

  Fly   187 YNFHLVSYAATSIFLYANILPAVLW---ALFKYSLKPVDSADAVETDSASYMPSLLSLMCIYGYS 248
                |:..|..:.|.|        |   :.|.|.|..:.:|..          ::|.::.:.||.
Mouse   180 ----LMGTAIGTCFGY--------WLGVSSFIYFLAYLCNAQI----------TMLQMLALLGYG 222

  Fly   249 LAIYIPVSILWVINISL-----LQWLLV-ITAALLSGTVLIAVLTPALRNSQFSLFLIVGILSAH 307
            |..:..|..: ..||.|     |.|||| ..:.|..|  |:..|..||..|       ||:....
Mouse   223 LFGHCIVLFI-TYNIHLHALFYLFWLLVGGLSTLRMG--LLNCLPVALGGS-------VGVADCG 277

  Fly   308 VVLAAGFLLYFFHNPTVPSLDPVAPTPAAPAAPA 341
            ...||..|.:           ...|..|.||..|
Mouse   278 PYSAAAALWH-----------AGCPAHALPALSA 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4645NP_001285171.1 Yip1 149..310 CDD:282716 41/171 (24%)
Yipf3XP_036016527.1 Yip1 148..255 CDD:398520 34/139 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.