DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4645 and Y53C12A.3

DIOPT Version :9

Sequence 1:NP_001285171.1 Gene:CG4645 / 32244 FlyBaseID:FBgn0030435 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_496093.2 Gene:Y53C12A.3 / 174528 WormBaseID:WBGene00013139 Length:270 Species:Caenorhabditis elegans


Alignment Length:276 Identity:65/276 - (23%)
Similarity:115/276 - (41%) Gaps:67/276 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 TSSAQGFSGAASSGGSQPQNSSLDGSAGGG----GGGAK------LSLFTIEYYQQFFNVDTYMV 124
            |.:.:..|.:.:.|....||......|..|    ..|:|      .|...|:.::.:|:||...|
 Worm    10 TENTRQRSNSNAGGSPDEQNPQFGMQAQLGKMMWEAGSKQVQDTFQSYGRIDLFRPYFDVDPAEV 74

  Fly   125 LERIANSMIPKRASGNYLRMNIGENPDLYGPFWITVT----LIFSIAISGNIASYLQQATDAYKW 185
            ..|:..|.||::.|      .|..:||||||..:.:|    |::::..||.:   :|..|     
 Worm    75 RTRLIRSFIPRKPS------QIQVSPDLYGPTMLVLTMVALLLYNMKTSGIV---IQNGT----- 125

  Fly   186 HYNFHLVSYAATSIFLYANILPAVLW-ALFKYSLKPVDSADAVETDSASYMPSLLSLMCIYGYSL 249
                 |:..|..:.|....::...|| |.|..               |:..| .|:::..:||||
 Worm   126 -----LMGTAMFTCFGSWMLISGALWIACFLL---------------AAEQP-FLTILSSFGYSL 169

  Fly   250 A----IYIPVSILWVINISLLQWLLV----ITAALLSGTVLI-AVLTPALRNSQFSLFLIVGI-L 304
            .    :.:..|:....:..|..::|:    :.:||..|.::. ....||.|      .|::|| :
 Worm   170 TSQCLVLLLTSLFHSSHDHLFFFVLLASFCVPSALRMGLIVCNQSRLPANR------LLLIGIAI 228

  Fly   305 SAHVVLAAGFLLYFFH 320
            :||::|.. :|.:.||
 Worm   229 AAHLLLII-YLHFGFH 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4645NP_001285171.1 Yip1 149..310 CDD:282716 40/175 (23%)
Y53C12A.3NP_496093.2 Yip1 34..>200 CDD:304430 45/200 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.