DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4645 and yipf1

DIOPT Version :9

Sequence 1:NP_001285171.1 Gene:CG4645 / 32244 FlyBaseID:FBgn0030435 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_002931506.2 Gene:yipf1 / 100490344 XenbaseID:XB-GENE-948257 Length:302 Species:Xenopus tropicalis


Alignment Length:318 Identity:117/318 - (36%)
Similarity:167/318 - (52%) Gaps:45/318 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 DPLADLIY---DMTSSAQGFSGAASSG----GSQPQNSSLDGSAGG-----GGGGAKLSLFTIEY 112
            |..|.|:.   |.|:.:.|.:.:.|.|    .||..:..:.|....     ||...:...:|.:|
 Frog    13 DDAASLLAANPDATTVSFGETESRSKGHRGNRSQEDDHLMSGEVSDKTELLGGQKKQAPFWTFDY 77

  Fly   113 YQQFFNVDTYMVLERIANSMIPKRASGNYLRMNIGENPDLYGPFWITVTLIFSIAISGNIASYLQ 177
            ||.||::||..||:||..|::| ....|::|:.:..||||||||||..||||:|.||||::::|.
 Frog    78 YQTFFDIDTLQVLDRIKGSVLP-MPGRNFIRLYVRSNPDLYGPFWICATLIFTITISGNLSNFLL 141

  Fly   178 QATDAYKWHY--NFHLVSYAATSIFLYANILPAVLWALFKYSLKPVDSADAVETDSASYMPSLLS 240
            ..... |:||  .|..||.|||:|:.|..::|..||....:....|.|       ..||  |.|.
 Frog   142 HQGKP-KYHYVPEFRKVSIAATAIYAYTWLVPLALWGFLTWRQSKVMS-------MVSY--SFLE 196

  Fly   241 LMCIYGYSLAIYIPVSILWVINISLLQWLLVITAALLSGTVLIAVLTPALR--NSQFSLFLIVGI 303
            ::|:|||||.||||.||:|:|:..:|:|:|:..|..|||.|||....||:|  |.:.::..:|.|
 Frog   197 IVCVYGYSLFIYIPTSIMWIIHAEMLRWVLMALAMSLSGAVLILTFWPAVREENRKIAVTTLVVI 261

  Fly   304 LSAHVVLAAGFLLYFFHNPTVPSLDPVAPTPAAPAAPAALKAVTQAVVNAVPG-NQTH 360
            :..|.:||.||:.|||        ||.....|..         |:..:||..| .|||
 Frog   262 MLLHALLAVGFVEYFF--------DPPEENYATH---------TRDSINATRGIVQTH 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4645NP_001285171.1 Yip1 149..310 CDD:282716 71/164 (43%)
yipf1XP_002931506.2 Yip1 96..273 CDD:398520 78/187 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 143 1.000 Domainoid score I4622
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5898
Inparanoid 1 1.050 178 1.000 Inparanoid score I3915
OMA 1 1.010 - - QHG54497
OrthoDB 1 1.010 - - D1425332at2759
OrthoFinder 1 1.000 - - FOG0001880
OrthoInspector 1 1.000 - - otm49243
Panther 1 1.100 - - O PTHR12822
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1890
SonicParanoid 1 1.000 - - X1411
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1313.110

Return to query results.
Submit another query.