DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Brms1 and SDS3

DIOPT Version :9

Sequence 1:NP_572840.1 Gene:Brms1 / 32243 FlyBaseID:FBgn0030434 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_012182.1 Gene:SDS3 / 854725 SGDID:S000001346 Length:327 Species:Saccharomyces cerevisiae


Alignment Length:135 Identity:28/135 - (20%)
Similarity:67/135 - (49%) Gaps:6/135 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 SELDASEIDRRRAEHIEDLLSLERQFNELREQYYVERINLIERQLAEVRSGRSEEFVQPQKELDK 109
            |..|.|..|:||......:..:.:.|...|:..|.:|:..::..|..:..|.:.::.:..::|::
Yeast     7 SNKDLSRKDKRRFNIESKVNKIYQNFYSERDNQYKDRLTALQTDLTSLHQGDNGQYARQVRDLEE 71

  Fly   110 KYRTRIEVADVLRKYRLQNIEHKYQSE-EQAAVQHFESEKHMAL--DNLREEFMERIRRLEEDRH 171
            :....:....:..:||:.....::|.: |:|..:|   ||.:.|  :.|.....::|::|:|:|.
Yeast    72 ERDLELVRLRLFEEYRVSRSGIEFQEDIEKAKAEH---EKLIKLCKERLYSSIEQKIKKLQEERL 133

  Fly   172 NVDIS 176
            .:|::
Yeast   134 LMDVA 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Brms1NP_572840.1 Sds3 59..>176 CDD:285764 22/119 (18%)
SDS3NP_012182.1 Sds3 21..310 CDD:400770 22/121 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4466
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21964
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.