DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Brms1 and Suds3

DIOPT Version :9

Sequence 1:NP_572840.1 Gene:Brms1 / 32243 FlyBaseID:FBgn0030434 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001116138.1 Gene:Suds3 / 71954 MGIID:1919204 Length:332 Species:Mus musculus


Alignment Length:226 Identity:63/226 - (27%)
Similarity:117/226 - (51%) Gaps:31/226 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 PHD----TSDEEEANEC---DSDDSSELDASEIDRRRAEHIEDLLSLERQFNELREQYYVERINL 84
            |.|    .|.|::...|   :||:.:| ||||.|  .|:|.|:      .:.|::||.|.:::..
Mouse    24 PEDEEELESAEDDERSCRGRESDEDTE-DASETD--LAKHDEE------DYVEMKEQMYQDKLAS 79

  Fly    85 IERQLAEVRSGRSEEFVQPQKELDKKYRTRIEVADVLRKYRLQNIEHKYQSEEQAAVQHFESEKH 149
            ::|||.:::.|..:|:.:..|:||::||.||..|::..:...:.:|..|..|::|||:.||.:|.
Mouse    80 LKRQLQQLQEGTLQEYQKRMKKLDQQYRERIRNAELFLQLETEQVERNYIKEKKAAVKEFEDKKV 144

  Fly   150 MALDNLREEFMERIRRLEEDRHNVDISWADWG-----TDKRQSKVRGP-----GRKKAVTVTGPY 204
            ...:||..|..|:.:.:|.::..::::.....     |.|.:.:...|     .|:|....   .
Mouse   145 ELKENLIAELEEKKKMIENEKLTMELTGDSMEVKPIMTRKLRRRPNDPVPIPDKRRKPAPA---Q 206

  Fly   205 VVYMLREEDIMEDWTIIR--KALKRSSSSAT 233
            :.|:|.:|.||||...:.  |:.||.:|.::
Mouse   207 LNYLLTDEQIMEDLRTLNKLKSPKRPASPSS 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Brms1NP_572840.1 Sds3 59..>176 CDD:285764 33/116 (28%)
Suds3NP_001116138.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..69 17/53 (32%)
Mediates interaction with USP17L2. /evidence=ECO:0000250 2..170 47/154 (31%)
Sds3 62..>178 CDD:285764 32/121 (26%)
Sin3 interaction domain (SID) 188..226 10/40 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 226..252 4/12 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4466
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.