DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Brms1 and Brms1l

DIOPT Version :9

Sequence 1:NP_572840.1 Gene:Brms1 / 32243 FlyBaseID:FBgn0030434 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001032845.1 Gene:Brms1l / 52592 MGIID:1196337 Length:323 Species:Mus musculus


Alignment Length:235 Identity:92/235 - (39%)
Similarity:150/235 - (63%) Gaps:14/235 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPV------KNGESDGEGDVSGGESEHSNSSQPHDTSDEEEANECDSDDSSELDASEIDRRRAEH 59
            |||      |......|.:|...|:|.|:|    :..|.|.::..:..||||:|..:.:|||.|.
Mouse     1 MPVHSRGDKKETNHHDEMEVDYAENEGSSS----EDEDTESSSVSEDGDSSEMDDEDCERRRMEC 61

  Fly    60 IEDLLSLERQFNELREQYYVERINLIERQLAEVRSGRSEEFVQPQKELDKKYRTRIEVADVLRKY 124
            ::::.:||:||.:|::|.|.||::.::.:|.||.:|::.|:::|...|.:..:.|.:||.:.|:.
Mouse    62 LDEMSNLEKQFTDLKDQLYKERLSQVDAKLQEVIAGKAPEYLEPLATLQENMQIRTKVAGIYREL 126

  Fly   125 RLQNIEHKYQSEEQAAVQHFESEKHMALDNLREEFMERIRRLEEDRHNVDISWADWGTDKRQSKV 189
            .|:::::||:.|.||:.||.||||.:..|.::.|..|:|||||||||::||:...|..:.:..|.
Mouse   127 CLESVKNKYECEIQASRQHCESEKLLLYDTVQSELEEKIRRLEEDRHSIDITSELWNDELQSRKK 191

  Fly   190 R----GPGRKKAVTVTGPYVVYMLREEDIMEDWTIIRKAL 225
            |    .|.:||.|.|:|||:||||::.||:||||.||||:
Mouse   192 RKDPFSPDKKKPVVVSGPYIVYMLQDLDILEDWTTIRKAM 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Brms1NP_572840.1 Sds3 59..>176 CDD:285764 45/116 (39%)
Brms1lNP_001032845.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..56 17/58 (29%)
Sds3 61..>179 CDD:312195 46/117 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833711
Domainoid 1 1.000 104 1.000 Domainoid score I6692
eggNOG 1 0.900 - - E1_KOG4466
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H9123
Inparanoid 1 1.050 175 1.000 Inparanoid score I4051
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49521
OrthoDB 1 1.010 - - D1456563at2759
OrthoFinder 1 1.000 - - FOG0002914
OrthoInspector 1 1.000 - - otm42407
orthoMCL 1 0.900 - - OOG6_105503
Panther 1 1.100 - - O PTHR21964
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5740
SonicParanoid 1 1.000 - - X1923
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1615.800

Return to query results.
Submit another query.