DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Brms1 and suds3

DIOPT Version :9

Sequence 1:NP_572840.1 Gene:Brms1 / 32243 FlyBaseID:FBgn0030434 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001003493.1 Gene:suds3 / 445099 ZFINID:ZDB-GENE-040801-236 Length:318 Species:Danio rerio


Alignment Length:217 Identity:59/217 - (27%)
Similarity:113/217 - (52%) Gaps:25/217 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 EHSNSSQPHDTSDEEEANEC---DSDDSSELDASEIDRRRAEHIEDLLSLERQFNELREQYYVER 81
            ::.|..:..|:.||:|....   ||::.:| ||||.|  .|:|.||      .:.|::||.|.::
Zfish     3 DYYNDEEELDSVDEDEDRSFRGRDSEEDTE-DASETD--LAKHDED------DYVEIKEQMYQDK 58

  Fly    82 INLIERQLAEVRSGRSEEFVQPQKELDKKYRTRIEVADVLRKYRLQNIEHKYQSEEQAAVQHFES 146
            :..::|||.:::.|..:|:.:..|:||::|:.|:..||:..:...:.:|..|..|::|||:.|:.
Zfish    59 LASLKRQLQQLQEGTLQEYQKRMKKLDQQYKERLRNADLFLQLETEQVERNYIKEKKAAVKEFDD 123

  Fly   147 EKHMALDNLREEFMERIRRLEEDRHNVDISWADWG-----TDKRQSKVRGP-----GRKKAVTVT 201
            :|....:||..|..|:.:.:|.::..::::.....     |.|.:.:...|     .|:|.... 
Zfish   124 KKVELKENLIAELEEKKKMVENEKLTMELTGDSMEVKPIMTRKLRRRPNDPVPIPDKRRKPAPA- 187

  Fly   202 GPYVVYMLREEDIMEDWTIIRK 223
              .:.|:|.:|.||||...:.|
Zfish   188 --QLNYLLSDEQIMEDLRTLNK 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Brms1NP_572840.1 Sds3 59..>176 CDD:285764 32/116 (28%)
suds3NP_001003493.1 Sds3 44..>160 CDD:285764 31/121 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4466
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1456563at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.