DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Brms1 and suds-3

DIOPT Version :9

Sequence 1:NP_572840.1 Gene:Brms1 / 32243 FlyBaseID:FBgn0030434 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001024114.1 Gene:suds-3 / 3565884 WormBaseID:WBGene00044204 Length:215 Species:Caenorhabditis elegans


Alignment Length:162 Identity:32/162 - (19%)
Similarity:63/162 - (38%) Gaps:19/162 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 GGESEHSNSSQPHDTSDEEEANECDSDDSSELDASEIDRRRAEHIEDLLSLERQFNELREQYYVE 80
            ||:.:......|......||....:     .|...|.:|::.:.:...:..|.|:..||.|....
 Worm    11 GGKRDRGTPRLPIRRPPSEEPAPLE-----HLTQEEYERKKTDILRRAVLAESQYIALRTQLRDN 70

  Fly    81 RINLIERQLAEVRSGRSEEFVQPQKE----LDKKY-----RTRIEVADVLRKYRLQNIEHKYQSE 136
            :........|.|.:|...|.:..::|    |.||.     :..:::|.:|.:|..:...::.|.|
 Worm    71 KFREAREYKANVAAGTDPELLAAKREAEDALSKKLDINQAKYELKMAQILDEYEAETAMNETQHE 135

  Fly   137 EQAAVQHFESEKHMALDNLREEFMERIRRLEE 168
            ::     :...|...:|..:|...|:.:|..|
 Worm   136 DK-----YVYAKGRYIDFFKELIAEKEKRERE 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Brms1NP_572840.1 Sds3 59..>176 CDD:285764 24/119 (20%)
suds-3NP_001024114.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
10.960

Return to query results.
Submit another query.