DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Brms1 and Brms1

DIOPT Version :9

Sequence 1:NP_572840.1 Gene:Brms1 / 32243 FlyBaseID:FBgn0030434 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001009605.1 Gene:Brms1 / 293668 RGDID:1311057 Length:246 Species:Rattus norvegicus


Alignment Length:240 Identity:95/240 - (39%)
Similarity:145/240 - (60%) Gaps:24/240 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPV-----KNGESDGEGDVS---GGESEHSNSSQPHDTSDEEEANECDSDDSSELDASEIDRRRA 57
            ||:     :..|.:.|||.:   .||::.|...:....::.||       :|||:|..:.:|||:
  Rat     1 MPIQPSGKETEEMEAEGDSAAEMNGEADESEEERSGSQTESEE-------ESSEMDDEDYERRRS 58

  Fly    58 EHIEDLLSLERQFNELREQYYVERINLIERQLAEVRSGRSEEFVQPQKELDKKYRTRIEVADVLR 122
            |.:.::|.||:||:||:|:.:.||::.:..:|.||.:.|:.|:.:|...|.:..:.||:||.:.:
  Rat    59 ECVSEMLDLEKQFSELKEKLFRERLSQLRLRLEEVGAERAPEYTEPLGGLQQSLKIRIQVAGIYK 123

  Fly   123 KYRLQNIEHKYQSEEQAAVQHFESEKHMALDNLREEFMERIRRLEEDRHNVDISWADWGTDKRQS 187
            .:.|..|.:||:.|.|.|.||.||||.:..|.|..|..|||:||||||.::||| ::|..||..|
  Rat   124 GFCLDVIRNKYECELQGAKQHLESEKLLLYDTLLGELQERIQRLEEDRQSLDIS-SEWWDDKLHS 187

  Fly   188 K--------VRGPGRKKAVTVTGPYVVYMLREEDIMEDWTIIRKA 224
            :        |....||||..|:|||:||||:|.||:||||.|:||
  Rat   188 RGSSKTWDSVPPSKRKKAPLVSGPYIVYMLQEIDILEDWTAIKKA 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Brms1NP_572840.1 Sds3 59..>176 CDD:285764 47/116 (41%)
Brms1NP_001009605.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..57 17/63 (27%)
Sds3 60..>177 CDD:400770 48/116 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166337296
Domainoid 1 1.000 104 1.000 Domainoid score I6554
eggNOG 1 0.900 - - E1_KOG4466
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 175 1.000 Inparanoid score I3958
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1456563at2759
OrthoFinder 1 1.000 - - FOG0002914
OrthoInspector 1 1.000 - - otm44471
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR21964
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1923
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.860

Return to query results.
Submit another query.