DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Brms1 and BRMS1

DIOPT Version :9

Sequence 1:NP_572840.1 Gene:Brms1 / 32243 FlyBaseID:FBgn0030434 Length:259 Species:Drosophila melanogaster
Sequence 2:XP_024304193.1 Gene:BRMS1 / 25855 HGNCID:17262 Length:304 Species:Homo sapiens


Alignment Length:236 Identity:92/236 - (38%)
Similarity:147/236 - (62%) Gaps:14/236 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPVKNGESDGEGDVSGGESEHSNSSQPHDTSDEEEANECDS-DDSSELDASEIDRRRAEHIEDLL 64
            |||:....|.|...:.|:|....:.:..::.:|...::.:| ::|||:|..:.:|||:|.:.::|
Human     1 MPVQPPSKDTEEMEAEGDSAAEMNGEEEESEEERSGSQTESEEESSEMDDEDYERRRSECVSEML 65

  Fly    65 SLERQFNELREQYYVERINLIERQLAEVRSGRSEEFVQPQKELDKKYRTRIEVADVLRKYRLQNI 129
            .||:||:||:|:.:.||::.:..:|.||.:.|:.|:.:|...|.:..:.||:||.:.:.:.|..|
Human    66 DLEKQFSELKEKLFRERLSQLRLRLEEVGAERAPEYTEPLGGLQRSLKIRIQVAGIYKGFCLDVI 130

  Fly   130 EHKYQSEEQAAVQHFESEKHMALDNLREEFMERIRRLEEDRHNVDISWADWGTDKRQSKVRGPG- 193
            .:||:.|.|.|.||.||||.:..|.|:.|..|||:||||||.::|:| ::|..||..:  ||.. 
Human   131 RNKYECELQGAKQHLESEKLLLYDTLQGELQERIQRLEEDRQSLDLS-SEWWDDKLHA--RGSSR 192

  Fly   194 ---------RKKAVTVTGPYVVYMLREEDIMEDWTIIRKAL 225
                     ||||..|:|||:||||:|.||:||||.|:|.|
Human   193 SWDSLPPSKRKKAPLVSGPYIVYMLQEIDILEDWTAIKKDL 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Brms1NP_572840.1 Sds3 59..>176 CDD:285764 47/116 (41%)
BRMS1XP_024304193.1 Sds3 60..>178 CDD:312195 48/118 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143553
Domainoid 1 1.000 104 1.000 Domainoid score I6710
eggNOG 1 0.900 - - E1_KOG4466
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 175 1.000 Inparanoid score I4060
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1456563at2759
OrthoFinder 1 1.000 - - FOG0002914
OrthoInspector 1 1.000 - - otm40341
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR21964
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5740
SonicParanoid 1 1.000 - - X1923
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.890

Return to query results.
Submit another query.