DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Brms1 and sds3

DIOPT Version :9

Sequence 1:NP_572840.1 Gene:Brms1 / 32243 FlyBaseID:FBgn0030434 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_594462.1 Gene:sds3 / 2541697 PomBaseID:SPAC25B8.02 Length:267 Species:Schizosaccharomyces pombe


Alignment Length:248 Identity:52/248 - (20%)
Similarity:100/248 - (40%) Gaps:61/248 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 EEEANECDSDDSSELDASEIDRRRAEHIEDLLSLERQFNELREQYYVERINLIERQLAEVRSGRS 97
            :.|..|.|...::.|.|||...::||                          :|.:|..:|:|..
pombe     9 DNEKEELDPLLNNPLTASEFRAKKAE--------------------------LEAELESIRNGTC 47

  Fly    98 EEFVQPQKELDKKYRTRIEVADVLRKYRLQNIEHKYQSEEQAAVQHFE----SEKHMALDNLREE 158
            :..:....||.:.....:|:|:..|.:.:...:.:|:.|.:||.:.:|    :.|.|.|.:|.  
pombe    48 KTLLDLADELRRSRDEELEIAERWRTFLVNRAQEEYEVEMKAAKEEYEYRCKTLKEMVLSHLN-- 110

  Fly   159 FMERIRRLEEDRHNVDISWADWGT-----------DKRQSKVRGPGRKKAVTVTGP-------YV 205
              |:.|::.|.:...||. ::..|           |:|:.:.|.....:..|...|       |:
pombe   111 --EKKRKIYEAKDMFDIG-SESSTLLLHDASSQFIDRRKLRHRRNAGNQQNTQQLPSLNFFDDYL 172

  Fly   206 VYMLREEDIMEDWTIIRKALKRSSSSATAAGTVTPTSGVSVSLSGLPAMAGAS 258
            ::...|..::..  .::.|::.|.:|      |.|||..:...|.|.:||.|:
pombe   173 LFPTDETAVIPQ--SVKNAVRNSVNS------VKPTSAEASLFSPLLSMANAN 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Brms1NP_572840.1 Sds3 59..>176 CDD:285764 22/120 (18%)
sds3NP_594462.1 Sds3 28..>150 CDD:285764 28/152 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4466
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.