DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Brms1 and dep1

DIOPT Version :9

Sequence 1:NP_572840.1 Gene:Brms1 / 32243 FlyBaseID:FBgn0030434 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_596582.1 Gene:dep1 / 2540595 PomBaseID:SPBC21C3.02c Length:491 Species:Schizosaccharomyces pombe


Alignment Length:167 Identity:38/167 - (22%)
Similarity:66/167 - (39%) Gaps:45/167 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PVKNGESDGEGD-------VSGGESEHSNSSQPH---DTSDEEEANECDSDDSSELDASEIDR-- 54
            |.|.|...|.|.       ||...|.:|.|....   :||.||...|.....|:...|.|.|.  
pombe   237 PRKGGPRSGVGSRKRKRATVSRKWSTNSESKIKRVALETSQEESDREIADRRSASEQAHEADDEK 301

  Fly    55 --RRAEHIEDLLSLERQFNELREQYYVERINLIERQLAEVRSGRSEEFVQPQKELDKKY------ 111
              :|.|..:.||::|.:|..||.:.|.:::         ::....||.:  |.|..:::      
pombe   302 AIKRKEAFDALLNIETEFTFLRNRLYGKKL---------LKLNEHEEMI--QNETHERFNACIDL 355

  Fly   112 -------RTRIEVADVLRKY-RLQNI------EHKYQ 134
                   |.|:...:::::. .::|:      :.|||
pombe   356 ITERRDDRVRLATENLMKQLGNIKNVMDYVTKQRKYQ 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Brms1NP_572840.1 Sds3 59..>176 CDD:285764 17/96 (18%)
dep1NP_596582.1 Sds3 308..>380 CDD:285764 13/82 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR21964
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.