DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Brms1 and brms1l

DIOPT Version :9

Sequence 1:NP_572840.1 Gene:Brms1 / 32243 FlyBaseID:FBgn0030434 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001096366.1 Gene:brms1l / 100124958 XenbaseID:XB-GENE-1002972 Length:322 Species:Xenopus tropicalis


Alignment Length:232 Identity:90/232 - (38%)
Similarity:145/232 - (62%) Gaps:9/232 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPVKNGE--SDGEGDVSGGESEHSNSSQPHDTSDEEEANECDSDDSSELDASEIDRRRAEHIEDL 63
            |||.:.|  .....|:.....|:..:|...|.||....:|  ..||||:|..:.:|||.|.::::
 Frog     1 MPVHSREKKESNHNDMEVDYPENEGTSSEEDDSDSSSGSE--EGDSSEMDDEDCERRRMECLDEM 63

  Fly    64 LSLERQFNELREQYYVERINLIERQLAEVRSGRSEEFVQPQKELDKKYRTRIEVADVLRKYRLQN 128
            .:||:||.:|::|.|.||::.::.:|.||.:|::.|:::|...|.:..:.|.:||.:.|:..|::
 Frog    64 SNLEKQFTDLKDQLYKERLSQVDAKLQEVIAGKAPEYLEPLANLQENMQIRTKVAGIYRELCLES 128

  Fly   129 IEHKYQSEEQAAVQHFESEKHMALDNLREEFMERIRRLEEDRHNVDISWADWGTD-----KRQSK 188
            :::|:..|.|||.||.||||.:..|.::.|..|:|||||||||::||:...|..:     ||:..
 Frog   129 VKNKHDCEIQAARQHCESEKLLLYDTVQSELEEKIRRLEEDRHSIDITSELWNDELQSRRKRKDP 193

  Fly   189 VRGPGRKKAVTVTGPYVVYMLREEDIMEDWTIIRKAL 225
            .....:||.|.|:|||:||||::.||:||||.||||:
 Frog   194 FSPDKKKKPVVVSGPYIVYMLQDLDILEDWTTIRKAM 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Brms1NP_572840.1 Sds3 59..>176 CDD:285764 45/116 (39%)
brms1lNP_001096366.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..56 17/56 (30%)
Sds3 59..>177 CDD:369987 46/117 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 115 1.000 Domainoid score I5957
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H9123
Inparanoid 1 1.050 178 1.000 Inparanoid score I3914
OMA 1 1.010 - - QHG49521
OrthoDB 1 1.010 - - D1456563at2759
OrthoFinder 1 1.000 - - FOG0002914
OrthoInspector 1 1.000 - - otm47517
Panther 1 1.100 - - O PTHR21964
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5740
SonicParanoid 1 1.000 - - X1923
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1212.110

Return to query results.
Submit another query.