DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Brms1 and brms1

DIOPT Version :9

Sequence 1:NP_572840.1 Gene:Brms1 / 32243 FlyBaseID:FBgn0030434 Length:259 Species:Drosophila melanogaster
Sequence 2:XP_002939374.2 Gene:brms1 / 100036672 XenbaseID:XB-GENE-992989 Length:316 Species:Xenopus tropicalis


Alignment Length:243 Identity:97/243 - (39%)
Similarity:154/243 - (63%) Gaps:24/243 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ESDGEGDVSGGESEHSNSSQPHDTSDEEEANECDS-DDSSELDASEIDRRRAEHIEDLLSLERQF 70
            |:|...:::|.|..        ||..|:.|::.|| ::||::|..:.:|||.|.::::..||:||
 Frog     5 EADSAAEMNGQEEA--------DTDGEDSASQSDSEEESSDMDDLDCERRRNECLDEMCHLEKQF 61

  Fly    71 NELREQYYVERINLIERQLAEVRSGRSEEFVQPQKELDKKYRTRIEVADVLRKYRLQNIEHKYQS 135
            :||:|:.:.||:|.::.:|.||.|||:.|::.|..||.|..:.|||||.:.:.:.|..|:|:|:.
 Frog    62 SELKEKLFKERLNELKAKLEEVNSGRAMEYINPLAELQKNMKIRIEVAGIYKGFCLDVIKHRYEC 126

  Fly   136 EEQAAVQHFESEKHMALDNLREEFMERIRRLEEDRHNVDISWADWGTDKRQSK--------VRGP 192
            |.|.|.||.||||.:..||::.|.:|||:||||||.::||| ::|..::.:||        .|..
 Frog   127 EVQGAKQHLESEKVLLFDNMQCELLERIQRLEEDRQSIDIS-SEWWDEELRSKRNRKKWDPFRSE 190

  Fly   193 GRKKAVTVTGPYVVYMLREEDIMEDWTIIRKA------LKRSSSSATA 234
            .:::...|:|||:|||||:.||:||||.|:||      .||.|.:..|
 Frog   191 KKRRVPLVSGPYIVYMLRDLDILEDWTAIKKAKAAVSPQKRKSDNVKA 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Brms1NP_572840.1 Sds3 59..>176 CDD:285764 52/116 (45%)
brms1XP_002939374.2 Sds3 50..>178 CDD:369987 55/128 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 115 1.000 Domainoid score I5957
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 178 1.000 Inparanoid score I3914
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1456563at2759
OrthoFinder 1 1.000 - - FOG0002914
OrthoInspector 1 1.000 - - otm47517
Panther 1 1.100 - - LDO PTHR21964
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1923
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.160

Return to query results.
Submit another query.