DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL49 and MRPL49

DIOPT Version :9

Sequence 1:NP_001285170.1 Gene:mRpL49 / 32242 FlyBaseID:FBgn0030433 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_004918.1 Gene:MRPL49 / 740 HGNCID:1176 Length:166 Species:Homo sapiens


Alignment Length:136 Identity:55/136 - (40%)
Similarity:80/136 - (58%) Gaps:6/136 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 YPEVEVVANPPEWRFVERLLPAKTVPQPVEKPKY--PSGWQPQKEDGSELGYHVARTKNHMVPVY 108
            ||  ..|.:..|::||||||||..:|.|.:...|  ||||||.::....|.|.|.|::.|.:|||
Human    35 YP--RFVESVDEYQFVERLLPATRIPDPPKHEHYPTPSGWQPPRDPPPNLPYFVRRSRMHNIPVY 97

  Fly   109 LHTRFRGQRRITVVRRVQGDIWTLEKDLRAVVEQSRNGKVCATRINELSGQIHFHGDHVDVLRDY 173
            .... .|.|::||:|:|:||||.|:||:...:.... ||...|::||::|.:...|.....|:.:
Human    98 KDIT-HGNRQMTVIRKVEGDIWALQKDVEDFLSPLL-GKTPVTQVNEVTGTLRIKGYFDQELKAW 160

  Fly   174 LKEKGF 179
            |.||||
Human   161 LLEKGF 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL49NP_001285170.1 Img2 93..174 CDD:282850 29/80 (36%)
MRPL49NP_004918.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 56..78 9/21 (43%)
Img2 84..166 CDD:398637 31/83 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145864
Domainoid 1 1.000 63 1.000 Domainoid score I10300
eggNOG 1 0.900 - - E1_KOG4034
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 99 1.000 Inparanoid score I5018
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46465
OrthoDB 1 1.010 - - D1534017at2759
OrthoFinder 1 1.000 - - FOG0005160
OrthoInspector 1 1.000 - - oto90248
orthoMCL 1 0.900 - - OOG6_104265
Panther 1 1.100 - - LDO PTHR13477
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2159
SonicParanoid 1 1.000 - - X4779
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.800

Return to query results.
Submit another query.