powered by:
Protein Alignment mRpL49 and R11D1.13
DIOPT Version :9
Sequence 1: | NP_001285170.1 |
Gene: | mRpL49 / 32242 |
FlyBaseID: | FBgn0030433 |
Length: | 179 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001122988.1 |
Gene: | R11D1.13 / 6418758 |
WormBaseID: | WBGene00045517 |
Length: | 95 |
Species: | Caenorhabditis elegans |
Alignment Length: | 38 |
Identity: | 7/38 - (18%) |
Similarity: | 17/38 - (44%) |
Gaps: | 8/38 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 136 LRAVVEQ--------SRNGKVCATRINELSGQIHFHGD 165
:::|::: :.|.:...|.|:.|...|..:.|
Worm 38 VQSVIDEHSAMIKIANSNKRAKKTEIDSLKADIDLYLD 75
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
mRpL49 | NP_001285170.1 |
Img2 |
93..174 |
CDD:282850 |
7/38 (18%) |
R11D1.13 | NP_001122988.1 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4034 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.