DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL49 and R11D1.13

DIOPT Version :9

Sequence 1:NP_001285170.1 Gene:mRpL49 / 32242 FlyBaseID:FBgn0030433 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_001122988.1 Gene:R11D1.13 / 6418758 WormBaseID:WBGene00045517 Length:95 Species:Caenorhabditis elegans


Alignment Length:38 Identity:7/38 - (18%)
Similarity:17/38 - (44%) Gaps:8/38 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 LRAVVEQ--------SRNGKVCATRINELSGQIHFHGD 165
            :::|:::        :.|.:...|.|:.|...|..:.|
 Worm    38 VQSVIDEHSAMIKIANSNKRAKKTEIDSLKADIDLYLD 75

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL49NP_001285170.1 Img2 93..174 CDD:282850 7/38 (18%)
R11D1.13NP_001122988.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.