DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL49 and mrpl49

DIOPT Version :9

Sequence 1:NP_001285170.1 Gene:mRpL49 / 32242 FlyBaseID:FBgn0030433 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_001373249.1 Gene:mrpl49 / 558658 ZFINID:ZDB-GENE-060810-161 Length:176 Species:Danio rerio


Alignment Length:134 Identity:48/134 - (35%)
Similarity:78/134 - (58%) Gaps:9/134 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 EVVANPPEWRFVERLLPAKTVPQPVEKPKY----PSGWQPQKEDGSELGYHVARTKNHMVPVYLH 110
            :::.:..|:||||||:|...:|.|   ||:    ||||.|..:....|.|.:.|::.|.||||..
Zfish    48 DIIESTEEFRFVERLIPPSRIPAP---PKHDGPAPSGWTPPSDTPPSLPYMIRRSRMHNVPVYSD 109

  Fly   111 TRFRGQRRITVVRRVQGDIWTLEKDLRAVVEQSRNGKVCATRINELSGQIHFHGDHVDVLRDYLK 175
            .: .|.:..|::|:::||||.|.|:::..:.: ..||...|::||::|.|...|.....|:|:|.
Zfish   110 IK-HGNQHSTLIRKIEGDIWALNKEVKEFLLE-LTGKDPPTQVNEITGSIRVKGQFDKELKDWLL 172

  Fly   176 EKGF 179
            .|||
Zfish   173 NKGF 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL49NP_001285170.1 Img2 93..174 CDD:282850 27/80 (34%)
mrpl49NP_001373249.1 Img2 92..176 CDD:398637 29/85 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579340
Domainoid 1 1.000 61 1.000 Domainoid score I10473
eggNOG 1 0.900 - - E1_KOG4034
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I5079
OMA 1 1.010 - - QHG46465
OrthoDB 1 1.010 - - D1534017at2759
OrthoFinder 1 1.000 - - FOG0005160
OrthoInspector 1 1.000 - - otm26575
orthoMCL 1 0.900 - - OOG6_104265
Panther 1 1.100 - - LDO PTHR13477
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2159
SonicParanoid 1 1.000 - - X4779
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1413.890

Return to query results.
Submit another query.