DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL49 and mrpl-49

DIOPT Version :9

Sequence 1:NP_001285170.1 Gene:mRpL49 / 32242 FlyBaseID:FBgn0030433 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_506179.2 Gene:mrpl-49 / 187809 WormBaseID:WBGene00011247 Length:187 Species:Caenorhabditis elegans


Alignment Length:199 Identity:58/199 - (29%)
Similarity:88/199 - (44%) Gaps:39/199 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 MLGSGL-------CQKLSQLTRQIH---------MQPALMSSFRSSREVQELDKYPEVEVVANPP 56
            ||||.|       ..:||..|..:.         .:.||....||...|:|.           |.
 Worm     1 MLGSSLRIFSPRAVSRLSFSTTSVEKAEKLWENPWKHALPEKSRSLATVEEA-----------PI 54

  Fly    57 EWRFVERLLPAKTVPQPVEKPKY--PSGWQPQKEDGSELGYHVARTKNHMVPVYLHTR--FRGQR 117
            :|.:||||:|.:.||...|..||  ||||.|..|......|::.|..:|::|:||..:  ...::
 Worm    55 DWSYVERLMPIEVVPNVPEHEKYPTPSGWTPPTEAAKTHQYYIRRRHDHLLPLYLERKRDLLNEK 119

  Fly   118 -------RITVVRRVQGDIWTLEKDLRAVVEQSRNGKVCATRINELSGQIHFHGDHVDVLRDYLK 175
                   .:..:|.|.|||:..|.|||:.:|: ..|...|:.::||.|:|...|....::..:..
 Worm   120 TLDFDYVELVTIRNVDGDIFACENDLRSYLEE-HLGHSIASHVDELKGRIKIKGAPRVLIEQFFY 183

  Fly   176 EKGF 179
            .|||
 Worm   184 SKGF 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL49NP_001285170.1 Img2 93..174 CDD:282850 23/89 (26%)
mrpl-49NP_506179.2 Img2 95..182 CDD:282850 23/87 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160158725
Domainoid 1 1.000 45 1.000 Domainoid score I8314
eggNOG 1 0.900 - - E1_KOG4034
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 78 1.000 Inparanoid score I3824
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46465
OrthoDB 1 1.010 - - D1534017at2759
OrthoFinder 1 1.000 - - FOG0005160
OrthoInspector 1 1.000 - - oto18788
orthoMCL 1 0.900 - - OOG6_104265
Panther 1 1.100 - - LDO PTHR13477
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2159
SonicParanoid 1 1.000 - - X4779
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.800

Return to query results.
Submit another query.