DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL49 and Mrpl49

DIOPT Version :9

Sequence 1:NP_001285170.1 Gene:mRpL49 / 32242 FlyBaseID:FBgn0030433 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_080522.1 Gene:Mrpl49 / 18120 MGIID:108180 Length:166 Species:Mus musculus


Alignment Length:133 Identity:53/133 - (39%)
Similarity:81/133 - (60%) Gaps:10/133 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 VANPPEWRFVERLLPAKTVPQPVEKPKY--PSGWQPQKEDGSELGYHVARTKNHMVPVYLHTRFR 114
            |.:..|::|||||||...:|:|.:...|  ||||||.::....|.|.|.|::.|.:|||.... .
Mouse    39 VESVDEYQFVERLLPPTKIPEPPKHKHYPTPSGWQPPRDPLPSLPYFVRRSRMHNIPVYKEIT-H 102

  Fly   115 GQRRITVVRRVQGDIWTLEKDLRAVVEQSRN---GKVCATRINELSGQIHFHGDHVDVLRDYLKE 176
            |.|::|::|:|:||||.|:||    ||:..:   ||...|::||::|.:...|...:.|:.:|.|
Mouse   103 GNRQMTLIRKVEGDIWALQKD----VEEFLSPLLGKTPITQVNEVTGTLRIKGYFDEQLKAWLLE 163

  Fly   177 KGF 179
            |||
Mouse   164 KGF 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL49NP_001285170.1 Img2 93..174 CDD:282850 30/83 (36%)
Mrpl49NP_080522.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 54..77 9/22 (41%)
Img2 82..161 CDD:282850 30/83 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835938
Domainoid 1 1.000 63 1.000 Domainoid score I10236
eggNOG 1 0.900 - - E1_KOG4034
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 97 1.000 Inparanoid score I5023
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46465
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005160
OrthoInspector 1 1.000 - - oto93827
orthoMCL 1 0.900 - - OOG6_104265
Panther 1 1.100 - - LDO PTHR13477
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2159
SonicParanoid 1 1.000 - - X4779
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.790

Return to query results.
Submit another query.