DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4404 and CG42526

DIOPT Version :9

Sequence 1:NP_572838.2 Gene:CG4404 / 32241 FlyBaseID:FBgn0030432 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001163401.1 Gene:CG42526 / 8674075 FlyBaseID:FBgn0260431 Length:245 Species:Drosophila melanogaster


Alignment Length:210 Identity:48/210 - (22%)
Similarity:84/210 - (40%) Gaps:31/210 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 FNVRFVQFVENQPCLWNYTHPGYSKKEDVQRAWQQVANDIKDTVRNCRERWRTIRSSFLR-SLKL 77
            |:...:..|:....::...|..|.:|:    ||..||...:.:|..|:.||:::|..::| :.|.
  Fly     4 FDALLIASVKRNVSIFEKYHTRYDRKQ----AWIAVAQACQKSVEYCQIRWKSLRDRYVRETQKP 64

  Fly    78 ARTQTGRGKRKYYLSKYLQFLVPFTKSRSCHKQLPGMVLRK----PGQAATAQQEDEVVAAEEE- 137
            |.|::  ..||:   |.|.||....:.|....:|...:...    ||....:|..|| :|.|.. 
  Fly    65 AATRS--NIRKF---KELDFLREHIRIRRKPNELCNTLNTNKTLVPGVTVDSQSADE-LALERNG 123

  Fly   138 -AKVSDGEMPLDVQVSEEEHRRNQEQDRE---QPTAC-----LPLRLHSIKVEHDSSNANQQLER 193
             .:....|..::.:..||..........|   :.:||     ||.      |...|.|...|.:.
  Fly   124 ITEFQPDEFIIEYKGEEEYLSETDNSSAEFISEDSACNIGSELPY------VTKPSFNGEGQSQT 182

  Fly   194 MVSQQSLVSVPAAAL 208
            .....|::::..:||
  Fly   183 QAKFMSVMNLIESAL 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4404NP_572838.2 MADF 17..103 CDD:214738 23/86 (27%)
BESS 267..301 CDD:281011
CG42526NP_001163401.1 MADF 8..85 CDD:214738 23/85 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12243
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.