DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4404 and Adf1

DIOPT Version :9

Sequence 1:NP_572838.2 Gene:CG4404 / 32241 FlyBaseID:FBgn0030432 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001260730.1 Gene:Adf1 / 47082 FlyBaseID:FBgn0284249 Length:274 Species:Drosophila melanogaster


Alignment Length:244 Identity:57/244 - (23%)
Similarity:97/244 - (39%) Gaps:73/244 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 FNVRFVQFVENQPCLWNYTHPGYSKKEDVQRA--WQQVANDIKDTVRNCRERWRTIRSSFLRSLK 76
            |::..::.|:..|.:::.:|  |:.|..|::|  |:|:|..:....:.|.:||:::|..|.|.:|
  Fly    12 FDLNLIEAVKLNPVIYDRSH--YNYKHFVRKAQTWKQIAETLGVPEQKCTKRWKSLRDKFAREMK 74

  Fly    77 LARTQTGRGKRKYYLSKYLQFLVPFTKSRSCHKQLPGMV---------LRKPGQAATAQQEDEV- 131
            |.:    ..:.:|:  |.:||||  ...|...:.|.|..         :..|.|...|||:..| 
  Fly    75 LCQ----ESRWRYF--KQMQFLV--DSIRQYRESLLGKCANGSQSANQVADPSQQQQAQQQTVVD 131

  Fly   132 ------------------------VAAEEEAKVSDG--------EMPLDVQVSEEEHRRNQEQDR 164
                                    |.::.:...:.|        |.||..:.|||||..|.    
  Fly   132 IFAQPFNGSATTSAQALTHPHEITVTSDAQLATAVGKDQKPYFYEPPLKRERSEEEHSDNM---- 192

  Fly   165 EQPTACLPLRLHSIKVEHDSSNANQQLERMVSQQSLVSVPAAALGNHLG 213
                      |::||:  ..:|.:|.:.  ...||...|....| |.||
  Fly   193 ----------LNTIKI--FQNNVSQAVS--AEDQSFGMVVTDML-NTLG 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4404NP_572838.2 MADF 17..103 CDD:214738 24/87 (28%)
BESS 267..301 CDD:281011
Adf1NP_001260730.1 MADF 15..95 CDD:214738 24/89 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438507
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.