DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4404 and CG11504

DIOPT Version :9

Sequence 1:NP_572838.2 Gene:CG4404 / 32241 FlyBaseID:FBgn0030432 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_651758.1 Gene:CG11504 / 43557 FlyBaseID:FBgn0039733 Length:410 Species:Drosophila melanogaster


Alignment Length:331 Identity:67/331 - (20%)
Similarity:108/331 - (32%) Gaps:122/331 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 LWNYTHPGYSKKEDVQRAWQQVANDIKDT--VRNCRERWRTIRSSFLRSLKLARTQTGRGKRKY- 89
            ||:.|...|.||:..||...:|:..:...  :....:::.|:|:.:.|.:       .|.|||. 
  Fly    21 LWDMTCDEYRKKDVKQRLLNEVSQVLGGNIPINELEKKFHTLRTQYHREI-------SRMKRKEP 78

  Fly    90 YLSKYLQF--LVPFTKSRSCHKQLPGMVLRKPGQAATAQQEDE------VVAAEEEAKVSDGEMP 146
            |.||:..|  ||..:...:|..        ..|:.....|.||      .|.|:..   ||...|
  Fly    79 YNSKWFGFKNLVFLSSPYACRS--------TKGRLKADLQGDERKFVLGEVTADHN---SDSSTP 132

  Fly   147 ------LDVQVSEEEHRRNQEQDREQPTACL----------------------PLRLHSIKVEHD 183
                  .:..::||..|:|....|.|....|                      |.:...:.|...
  Fly   133 ANHNSNTNANMNEEYLRKNHASSRAQELEKLIEETTKDVDDIDESELEEGEVKPKQAKEMSVRFV 197

  Fly   184 SSNANQQLERMVS-QQSLVSVPAAALGNHLGWSDLTQWFKGHGSG--HHKLTTTTTTPTS----- 240
            |.|..::.|.:.: .|:|:.:      :|.|.:.....|:.:.||  |::.|.|.:|.:|     
  Fly   198 SLNEQEETEPLENHHQTLMDL------HHQGNAVEAVSFQANESGELHYQTTPTQSTGSSSVHVM 256

  Fly   241 ----------------------------PPP------PPQPAT-----------------SALSV 254
                                        |||      ...||:                 :|.||
  Fly   257 PTRIIKIQRRDTSSGQEDSYFEEHTQLHPPPVKRMYYEASPASHNTTSILSPALESSANGTASSV 321

  Fly   255 FTGGPG 260
            .|..||
  Fly   322 LTTSPG 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4404NP_572838.2 MADF 17..103 CDD:214738 22/79 (28%)
BESS 267..301 CDD:281011
CG11504NP_651758.1 MADF_DNA_bdg 11..92 CDD:287510 22/77 (29%)
CytochromB561_N 238..>409 CDD:286826 16/90 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12243
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.