DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4404 and jigr1

DIOPT Version :9

Sequence 1:NP_572838.2 Gene:CG4404 / 32241 FlyBaseID:FBgn0030432 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001097920.1 Gene:jigr1 / 43093 FlyBaseID:FBgn0039350 Length:336 Species:Drosophila melanogaster


Alignment Length:267 Identity:52/267 - (19%)
Similarity:103/267 - (38%) Gaps:58/267 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 FNVRFVQFVENQPCLWNYTHPGYSKKEDVQRAWQQVANDIKDTVRNCRERWRTIRSSFLRSLKLA 78
            |::..::...:.|.|::.::..:..|..|...|:|:|:.:.....:.|||..|:|:.:  :::..
  Fly    29 FDLGLIREYRSHPVLYDRSNKRFKDKLYVAHIWEQIAHKLGYDATSIRERMTTLRNRY--NIEKR 91

  Fly    79 RTQTGRGKR--KYYLSKYLQFLVPFTKSRSCHKQLPGMVLRKPGQAATAQQEDEVV--------- 132
            |.:.|...:  ::.|.:.||||....:.|...|.:            :.::|||..         
  Fly    92 RVENGLSTQSSQWPLFESLQFLGDHIRPRRSFKNM------------SVKEEDEETYEVDDCRSD 144

  Fly   133 ----------AAEEEAKVSDGEMPLDVQV--------SEEEHRRNQEQDREQPTACLPLRLHSIK 179
                      ..|:::::.|.|..|.|..        |:|.::..:..:.|.|..    :.::..
  Fly   145 SNGHMNSIKDELEDDSEIFDCEQALPVTTVLGIPLNNSDEANKSQRSTNGEMPNG----KGYNHF 205

  Fly   180 VEHDSSNANQQLERMVSQQSLVSVPAAALGNHLGWSDLTQWFKGHGSGHH---KLTTTTTTPTSP 241
            .|........|.|.::|  |.:..|..:  |..|    :|....|.|...   .|:.:...||.|
  Fly   206 AESYHRRHQNQPEYIIS--SPIVNPMRS--NKRG----SQHLDDHPSKRRVDDSLSISGYYPTQP 262

  Fly   242 PPPPQPA 248
            ..|..||
  Fly   263 LAPLPPA 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4404NP_572838.2 MADF 17..103 CDD:214738 19/87 (22%)
BESS 267..301 CDD:281011
jigr1NP_001097920.1 MADF 33..118 CDD:214738 19/86 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438469
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.