DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4404 and CG12768

DIOPT Version :9

Sequence 1:NP_572838.2 Gene:CG4404 / 32241 FlyBaseID:FBgn0030432 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001262229.1 Gene:CG12768 / 40513 FlyBaseID:FBgn0037206 Length:429 Species:Drosophila melanogaster


Alignment Length:296 Identity:65/296 - (21%)
Similarity:110/296 - (37%) Gaps:49/296 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 RFVQFVENQPCLWNYTHPGYSKKEDVQRA--WQQVANDIKDTVRNCRERWRTIRSSFLRSL---K 76
            |.::.|...|.||:...|.| |:.|.::|  |.::...........:..:.::|..|.|.|   |
  Fly    12 RLIELVRLNPILWDCRLPHY-KRSDKRKAIKWNELGRLFNVNGERVQRTFTSLREIFRRELNHEK 75

  Fly    77 LARTQTGRGKRKYY-LSKYLQFLVPFTKSRSCHKQLPGMVLRKPGQAATAQQEDEVVAAEEEAKV 140
            :..|...:.|.:|| ...:|:.::...|||...|.  |.:...|....::...:..|:.......
  Fly    76 MLGTTRFKSKWEYYDAMAFLKEVIRERKSRERIKH--GSLDSAPVATGSSNNNNNCVSRNSSNNN 138

  Fly   141 SDGEMPLDVQV---SEEEHRRNQEQDREQPTACLPLRLHSIKVEHDSSNANQQLERMVSQQSLVS 202
            |......:.|.   |:..:..||.|.:.:|.:.||:.:.|:      |....||...:.||:   
  Fly   139 SSSAALDEYQYFAPSDPNNPNNQPQLQPEPKSSLPVTIPSL------SLTLSQLPVALQQQA--- 194

  Fly   203 VPAAALGNHLG----WSDLTQWFKGHGSGHHKLTTTTTTPTSPPPPPQPATSALSVFTG------ 257
                   .||.    ..|:|.......|....||..|..|.:...|.|..:|:.|..:.      
  Fly   195 -------QHLQALQLQPDVTLTSLQKQSLPTSLTNATPAPLAQTSPAQVLSSSRSCSSSPSIYIK 252

  Fly   258 ----GPGGG-------GSQPDADYSFLISLHPYIKE 282
                .|.||       |:.|:|....|.::.|..|:
  Fly   253 DEPCSPAGGCPEEVMTGNGPEATRKKLATIRPQTKQ 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4404NP_572838.2 MADF 17..103 CDD:214738 21/91 (23%)
BESS 267..301 CDD:281011 4/16 (25%)
CG12768NP_001262229.1 MADF 12..100 CDD:214738 21/88 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438485
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.