DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4404 and stwl

DIOPT Version :9

Sequence 1:NP_572838.2 Gene:CG4404 / 32241 FlyBaseID:FBgn0030432 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001261839.1 Gene:stwl / 39581 FlyBaseID:FBgn0003459 Length:1037 Species:Drosophila melanogaster


Alignment Length:332 Identity:74/332 - (22%)
Similarity:121/332 - (36%) Gaps:91/332 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 NVRFVQFVENQPCLWNYTHPGYSKKEDVQRAWQQVANDIKDTVRNCRERWRTIRSSFLR--SLKL 77
            |:..::.||.|..|::.|...|.|:...:.||..||:::.::|..|:.|||.:|:.:.|  :...
  Fly     8 NLMLLRSVEKQTALYDRTDENYRKRLPSENAWDMVASEVGESVEKCKRRWRQLRNDYTRWCNADA 72

  Fly    78 ARTQTGRGKRKYYLSKYLQFL-----------------VPFTKSRSCHKQLPGM-----VLRKPG 120
            .|.:.|:.:..|.|:..|:||                 |...|.|..::...|:     ...|..
  Fly    73 NRRRNGQRRLAYPLADELRFLDRHLNIADDMAADDDRSVSSDKDRDNNRDSEGVDHHAQASLKER 137

  Fly   121 QAATAQQEDEVVAAEE-------EAKVSDGEMPLDVQVS-----EEEHRRNQEQDREQPTACLPL 173
            .::|::...||..|.:       :.|..:.|.|.|.|.|     ||:....:|.|..:....|..
  Fly   138 ASSTSKLVKEVKLASQVRKEKSSQDKRENWENPGDKQRSRKKSAEEKLNDLEESDEPEKVPELDS 202

  Fly   174 RLHS-------IKVEH---------DSSNANQQLERMVSQQSL--------VSVPAAALGNH--- 211
            .|.|       :..||         |...:||:.| :..::||        ||.|...:...   
  Fly   203 FLQSDNEDDECMDEEHLEDLEGFDFDLEQSNQEKE-LTPEKSLEKNNTDSTVSQPEFFVKQTRDP 266

  Fly   212 ----LGWSDLTQWF----------------------KGHGSGHHKLTTTTTTPTSPPPPPQPATS 250
                :|..:.|..|                      ..:|....|..|.:.| |||...|:.|..
  Fly   267 RLLIIGRKNSTSSFAESKASKSISGDPLETAMEDSGDEYGRDGEKRVTGSDT-TSPTRRPRRAAR 330

  Fly   251 ALSVFTG 257
            |...|.|
  Fly   331 ASISFAG 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4404NP_572838.2 MADF 17..103 CDD:214738 26/104 (25%)
BESS 267..301 CDD:281011
stwlNP_001261839.1 MADF 11..98 CDD:214738 25/86 (29%)
BESS 604..637 CDD:281011
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001895
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.