DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4404 and CG6163

DIOPT Version :9

Sequence 1:NP_572838.2 Gene:CG4404 / 32241 FlyBaseID:FBgn0030432 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001261709.1 Gene:CG6163 / 39274 FlyBaseID:FBgn0036155 Length:428 Species:Drosophila melanogaster


Alignment Length:260 Identity:46/260 - (17%)
Similarity:75/260 - (28%) Gaps:80/260 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 KDDPVFN-VRFVQFVENQPCLWNYTHPGYSKKEDVQRAWQQVANDIKDTVRNCRER--WRTIRSS 70
            |:||..| .:.::.::..|.:|:..:..:..:......|.::|......|...:.:  |..::..
  Fly     3 KEDPFVNRAQLLKAIKKYPEIWDSNNKLHMCRSVTSPMWTEIAEQFGGHVPTVKLQSIWSQMKYH 67

  Fly    71 FLRSLKLARTQTGRGKRKYYLSKYLQFLVPFTKSRSCHKQLPGMVLRKPGQAATAQQEDEVVAAE 135
            :...:........|...|:...:.:.|:...|.::....|       ..|.:......|....|.
  Fly    68 YHNLVHRQILHKDRFNTKWEHFEPMSFMYNITVAKIVGAQ-------SSGGSGGGTSSDAPSTAT 125

  Fly   136 EEAKVSDGEMPLDVQVSEEEHRRNQEQDREQPTACLPLRLHSIKVEHDSSNANQQLERMVSQQSL 200
            |.|.|  ||.|                  ..|.|..||                           
  Fly   126 EAATV--GEEP------------------AAPVAPPPL--------------------------- 143

  Fly   201 VSVPAAALGNHLGWSDLTQWFKGHGSGHHKLTTTTTTPTSP--------PPPPQPATSALSVFTG 257
               |.|..|            :|..||......|.||||:|        ||..|......:.|||
  Fly   144 ---PTATHG------------RGRPSGSFSWLQTATTPTAPQLPHLITQPPHSQGHGMTYTAFTG 193

  Fly   258  257
              Fly   194  193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4404NP_572838.2 MADF 17..103 CDD:214738 9/87 (10%)
BESS 267..301 CDD:281011
CG6163NP_001261709.1 MADF 12..98 CDD:214738 9/85 (11%)
MADF 226..316 CDD:214738
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438510
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.