DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4404 and CG9948

DIOPT Version :9

Sequence 1:NP_572838.2 Gene:CG4404 / 32241 FlyBaseID:FBgn0030432 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001261492.1 Gene:CG9948 / 38757 FlyBaseID:FBgn0035721 Length:218 Species:Drosophila melanogaster


Alignment Length:225 Identity:51/225 - (22%)
Similarity:86/225 - (38%) Gaps:42/225 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RKDDPVFNVRFVQFVENQPCLWNYTHPGYSK------KEDVQRAWQQVANDIKDTVRNCRERWRT 66
            :|:.| |:.:.:..||..|.|  |...|.|.      |.|:   |.::|..:...|..|..||..
  Fly     6 KKNRP-FDFKLIDLVEPNPVL--YKRSGLSNYDAMKAKTDI---WARIAEMMGCDVDFCLMRWNN 64

  Fly    67 IRSSFLRSLKLARTQTGRGKRKYYLSKYLQFLVPFTKSRSCHKQLPGMVLRKP---GQAATAQQE 128
            :...|.:..:.|.|.   |....||.: |:||...        |.|..|..||   .|.||.|.|
  Fly    65 LHYQFRKEFRRADTS---GSTWPYLER-LRFLAEI--------QPPSKVKTKPKTNKQEATIQTE 117

  Fly   129 DEVVAAEEEAKVSDGEMP-------LDVQVSEEEHRRNQEQ---DREQPTACLPLRLHSIKVEHD 183
            ..|....:  ...||::|       ::..:.|...:..||:   :.::|...:..|...::::..
  Fly   118 TPVQFLWD--TFEDGDVPQQSSTFIIEEVIEEPSEQIIQEEIIYEEQEPAEIISPRSSFLQMDQI 180

  Fly   184 SSNANQQLERMVSQQ---SLVSVPAAALGN 210
            .:...:...|...::   .|:.....||.|
  Fly   181 LAQLKEPQRRRAERRITAFLLKCQLRALSN 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4404NP_572838.2 MADF 17..103 CDD:214738 24/91 (26%)
BESS 267..301 CDD:281011
CG9948NP_001261492.1 MADF 14..95 CDD:214738 24/89 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12243
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.