DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4404 and hng1

DIOPT Version :9

Sequence 1:NP_572838.2 Gene:CG4404 / 32241 FlyBaseID:FBgn0030432 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_611558.2 Gene:hng1 / 37412 FlyBaseID:FBgn0034599 Length:315 Species:Drosophila melanogaster


Alignment Length:310 Identity:59/310 - (19%)
Similarity:100/310 - (32%) Gaps:103/310 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 DDPVFNVRFVQFVENQPCLWNYTHPGYSKKEDVQRAWQQVANDIKDTVRNCRERWRTIRSSFLRS 74
            ||.  ::..:|.:...|.|::...|.:...:..:..|.:||:.:..::.:.|.||..:|..:.|.
  Fly     9 DDS--DILLIQTIRETPSLYDPQLPSFRLSQRKEEDWAKVADLLNISISDARRRWTCLRDRYSRE 71

  Fly    75 LKLARTQ-TGR-GKRKYYLSKYLQFLVPFTKSRSCHKQLPGMVLRKPGQAATAQQEDEVVAAEEE 137
            ||..|.. :|. |...::  :.:.||..|.:.|                                
  Fly    72 LKQKRLHPSGEFGHNDFF--RKMDFLRDFVRKR-------------------------------- 102

  Fly   138 AKVSDGEMPLDVQVSEEEHRRNQEQDREQ-PTAC------------LPLRLHSIKVEHDSSNA-- 187
                             ..||.:|:|||| ||..            ||:...:: :|...|:|  
  Fly   103 -----------------RERRGRERDREQKPTGWMKVDLQRRRRTRLPIDTETL-IEEQGSHAYD 149

  Fly   188 --------NQQLERMVSQQSLVSVPAAALGNHLGWSDLTQWFKGHGSGHHKLTTTTTTPTSPPP- 243
                    :.:||...:|....||...|........:....|.|......|:...|..|....| 
  Fly   150 EGEEQHDYDAKLESHTTQSETYSVVVEADDGQEPEQESFDEFLGDAECEQKVKVVTIHPEIAAPN 214

  Fly   244 ---PPQPATSALSVFTGGPGGGGSQPDADYSFLISLHPYIKEMNGKQNRK 290
               .|:|..|               ..||.::|:.:.|     |..|.|:
  Fly   215 ATSAPEPIES---------------NHADLNYLVCMPP-----NANQERE 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4404NP_572838.2 MADF 17..103 CDD:214738 20/87 (23%)
BESS 267..301 CDD:281011 7/24 (29%)
hng1NP_611558.2 MADF 15..98 CDD:214738 19/84 (23%)
BESS 264..298 CDD:281011
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438505
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.