DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4404 and hng1

DIOPT Version :10

Sequence 1:NP_572838.2 Gene:CG4404 / 32241 FlyBaseID:FBgn0030432 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_611558.2 Gene:hng1 / 37412 FlyBaseID:FBgn0034599 Length:315 Species:Drosophila melanogaster


Alignment Length:310 Identity:59/310 - (19%)
Similarity:100/310 - (32%) Gaps:103/310 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 DDPVFNVRFVQFVENQPCLWNYTHPGYSKKEDVQRAWQQVANDIKDTVRNCRERWRTIRSSFLRS 74
            ||.  ::..:|.:...|.|::...|.:...:..:..|.:||:.:..::.:.|.||..:|..:.|.
  Fly     9 DDS--DILLIQTIRETPSLYDPQLPSFRLSQRKEEDWAKVADLLNISISDARRRWTCLRDRYSRE 71

  Fly    75 LKLARTQ-TGR-GKRKYYLSKYLQFLVPFTKSRSCHKQLPGMVLRKPGQAATAQQEDEVVAAEEE 137
            ||..|.. :|. |...::  :.:.||..|.:.|                                
  Fly    72 LKQKRLHPSGEFGHNDFF--RKMDFLRDFVRKR-------------------------------- 102

  Fly   138 AKVSDGEMPLDVQVSEEEHRRNQEQDREQ-PTAC------------LPLRLHSIKVEHDSSNA-- 187
                             ..||.:|:|||| ||..            ||:...:: :|...|:|  
  Fly   103 -----------------RERRGRERDREQKPTGWMKVDLQRRRRTRLPIDTETL-IEEQGSHAYD 149

  Fly   188 --------NQQLERMVSQQSLVSVPAAALGNHLGWSDLTQWFKGHGSGHHKLTTTTTTPTSPPP- 243
                    :.:||...:|....||...|........:....|.|......|:...|..|....| 
  Fly   150 EGEEQHDYDAKLESHTTQSETYSVVVEADDGQEPEQESFDEFLGDAECEQKVKVVTIHPEIAAPN 214

  Fly   244 ---PPQPATSALSVFTGGPGGGGSQPDADYSFLISLHPYIKEMNGKQNRK 290
               .|:|..|               ..||.::|:.:.|     |..|.|:
  Fly   215 ATSAPEPIES---------------NHADLNYLVCMPP-----NANQERE 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4404NP_572838.2 MADF 17..103 CDD:214738 20/87 (23%)
BESS 267..301 CDD:460758 7/24 (29%)
hng1NP_611558.2 MADF 15..98 CDD:214738 19/84 (23%)
BESS 264..298 CDD:460758
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.