DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4404 and CG7745

DIOPT Version :9

Sequence 1:NP_572838.2 Gene:CG4404 / 32241 FlyBaseID:FBgn0030432 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_610671.1 Gene:CG7745 / 36210 FlyBaseID:FBgn0033616 Length:506 Species:Drosophila melanogaster


Alignment Length:254 Identity:58/254 - (22%)
Similarity:101/254 - (39%) Gaps:45/254 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 KKEDVQRAWQQVANDIKDTVRNCRERWRTIRSSFLRSLKLARTQTGRGKRKYYLSKYLQFLVPFT 102
            |.|....|||.:|..::..|..|::||:.:|..::...|...........:.||.| ::||....
  Fly    32 KYETKDEAWQLIAMKLRTDVDTCKKRWKYLRERYVSQRKQGDPPVYEHLSRPYLEK-MKFLDQHI 95

  Fly   103 KSRSCHKQLPGMVLRKPGQAATAQQEDEVVAAEEEAKVSDGEMPLDVQV--SEEEHRRNQEQDRE 165
            :.|..::.:|.. |..| |:|.:...:|.     :...|:|.|....|.  |.:.|..:|...:.
  Fly    96 QPRKSYRHVPNF-LTSP-QSANSSGYNEY-----QVDKSNGSMKNVSQFGSSGQSHLYHQPDQQH 153

  Fly   166 QPTACLPLRLHS-------IKVEHD-------SSNANQQLERMVS---QQSLVSVPAAALGNHLG 213
            ..:|...:...:       :|:|.|       ::.|:|||:.:..   ||...:|.|....:..|
  Fly   154 AMSALSNVAASALENVNGQVKIEADQVFRDFAAAVASQQLQHISQSQMQQQAAAVAAVMADSSQG 218

  Fly   214 WSDLTQW------FKGHGSGHHKLTTTTTTPTSPPPPPQPATSALSVFTGGPGGGGSQP 266
            :.|  |:      ..|..:....||:|:::..||          ||....|.|.|...|
  Fly   219 YQD--QYKDGSVGMNGAQNSAGSLTSTSSSMKSP----------LSSPLQGIGAGSHHP 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4404NP_572838.2 MADF 17..103 CDD:214738 17/64 (27%)
BESS 267..301 CDD:281011 58/254 (23%)
CG7745NP_610671.1 MADF 5..96 CDD:214738 17/64 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438508
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12243
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.