DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4404 and Coop

DIOPT Version :9

Sequence 1:NP_572838.2 Gene:CG4404 / 32241 FlyBaseID:FBgn0030432 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001260776.1 Gene:Coop / 35677 FlyBaseID:FBgn0263240 Length:358 Species:Drosophila melanogaster


Alignment Length:343 Identity:67/343 - (19%)
Similarity:127/343 - (37%) Gaps:72/343 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 PVFNV-RFVQFVENQPCLWNYTHPGYSKKEDVQRAWQQVANDIKDTVRNCRERWRTIRSSFLRSL 75
            |:..| |.:..|..:|.||...:....|:.|:...|.:|..|:......||.:|..:|.:| |.:
  Fly    36 PIETVKRLIAAVSRRPMLWLRNNANGQKRSDITPVWFEVGQDVNLPADICRIKWGHLRDNF-RKV 99

  Fly    76 KLARTQTGRGKRKYYLSKYLQFLVP------FTKSRSCHKQLPGMVLRKPGQ--------AATAQ 126
            .:....:......:.....::|:.|      ..::||..|:.|      ||.        .....
  Fly   100 YIRNNLSNETPSSWRFYNDMRFMEPAVHENIMRQTRSSSKKHP------PGHWTENNNVLGPDKY 158

  Fly   127 QEDEVVAAEEEAKVS---DGEM-------------PLDVQVSEEEHRRNQEQDREQPTACLPLRL 175
            ....:||.|...::|   |.|:             ..|.|..|.:..:::...||:...      
  Fly   159 DSMPIVATEPICELSHSYDSELHQPSFSDISSFFEDRDCQPPENKRFKSEPSQREEDEE------ 217

  Fly   176 HSIKVEHDSSNANQQLER-------------------MVSQQSLVSVPAAALGNHLGWSDLTQWF 221
            .....:.|:::.|.:.||                   ....:..|:...|...:| |.|.|    
  Fly   218 DDDDFDEDAASENLEEERGNRADAASSGVFTIEVLDDDDEMEQAVTKTKANNTSH-GGSSL---- 277

  Fly   222 KGHGSGHHKLTTTTTTPTSPPPPPQPATSALSVFTGGPGGGGSQPDADYSFLISLHPYIKEMNGK 286
              ......|:.:.:.:||:..|....:|...:  ...|.||..|.:||..||:||.|:::.::.:
  Fly   278 --KSEQEAKVFSNSQSPTADLPFKYISTDVAT--NTDPSGGDLQDEADRMFLLSLMPFLQRLDSR 338

  Fly   287 QNRKFRQKVVGLIDDILD 304
            :..:.|||:..::.:.|:
  Fly   339 RRLRVRQKLQNVLIEELE 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4404NP_572838.2 MADF 17..103 CDD:214738 18/91 (20%)
BESS 267..301 CDD:281011 10/33 (30%)
CoopNP_001260776.1 MADF 42..124 CDD:214738 17/82 (21%)
BESS 320..353 CDD:281011 10/32 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12243
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.