DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4404 and CG10949

DIOPT Version :9

Sequence 1:NP_572838.2 Gene:CG4404 / 32241 FlyBaseID:FBgn0030432 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001286101.1 Gene:CG10949 / 35310 FlyBaseID:FBgn0032858 Length:459 Species:Drosophila melanogaster


Alignment Length:248 Identity:57/248 - (22%)
Similarity:103/248 - (41%) Gaps:46/248 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RKD-------DPVFNVRFVQFVENQPCLWNYTHPGYSKKEDVQ-RAWQQVANDIKDTVRNCRERW 64
            |||       |.:.|.:.::.|::.|.|::......||....: .||::::.::..:...|..||
  Fly   124 RKDEEEEDSQDDLLNEQLIELVKSHPVLYDRHKIRVSKNLAAKNEAWREISENLNVSEELCYNRW 188

  Fly    65 RTIRSSFLRSLKLAR-TQTGRGKRKY-----YLSKYLQFLVPF---------------TKSRSCH 108
            :.:|..|.|..:..: .|:.....:|     :|.::.:..||.               ..|....
  Fly   189 KKLRDRFGREFRSHQINQSTPITWRYFNDLLFLGRHFRKGVPLVLENIKRRGRPPKAGNPSGKTS 253

  Fly   109 KQLPGMVLRKPGQAATAQ----------QEDEVVAAEEEAKV-SDGEM--PLDVQVSEEEHRRNQ 160
            ||..|||:....|...|.          ::|..:|.:||.:: |:.|.  |.|..:||...|::.
  Fly   254 KQPEGMVISSGEQIWGADYPYSTDNDDLEDDLELAYDEEIEILSEAEQATPYDFILSEATARQDL 318

  Fly   161 EQDRE-QPTACLPLRLHSIKVEHDSSNANQQLERMVSQQSLVSVPAAALGNHL 212
            |..:: |.|...|..  |.::.|..:..|..:|...|... .|||:||:.:.|
  Fly   319 EPPQQLQVTTTTPAT--SEEIIHTIARVNPVVEESSSLPG-DSVPSAAISDKL 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4404NP_572838.2 MADF 17..103 CDD:214738 18/107 (17%)
BESS 267..301 CDD:281011
CG10949NP_001286101.1 MADF 5..91 CDD:214738
MADF 140..226 CDD:214738 16/85 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438465
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12243
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.