DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4404 and CG11723

DIOPT Version :9

Sequence 1:NP_572838.2 Gene:CG4404 / 32241 FlyBaseID:FBgn0030432 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001259906.1 Gene:CG11723 / 33388 FlyBaseID:FBgn0031391 Length:350 Species:Drosophila melanogaster


Alignment Length:316 Identity:63/316 - (19%)
Similarity:122/316 - (38%) Gaps:77/316 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 NVRFVQFVENQPCLWNYTHPGYSKKEDVQRAWQQVANDIKDTVRNCRERWRTIRSSFLRSLKLAR 79
            |.|.:|.|..:.|||:.......:.:|....|..||..::..|..|::|::.:|.|:...::  :
  Fly     5 NYRLIQEVSKRRCLWDTNMSISYRNQDAALQWASVAQIMQQDVSICKKRFKGMRDSYRAEVR--K 67

  Fly    80 TQTGRGKRKYYLSKYLQFLVPFTKSRSCHKQL---PGMVLRKPGQAATAQQEDEVVAAEEEAKVS 141
            .|..|.:..::         |:.:|....:|:   .|:|...|.......::.||.   |..::.
  Fly    68 IQQKRIEMSHW---------PYFRSLEFMRQIFDPEGLVPFPPEPFVMNTEQPEVF---EPTRLV 120

  Fly   142 DGEMPLDV--------QVSEEEHRRN----QEQDREQPTACLPLRLHSIKVEHDSSNANQQLERM 194
            |..:.||:        ::.|:..:|.    |:...::.:...||         |||::       
  Fly   121 DFAIDLDLDNDDSVDFEIIEDIFKREPSVPQDSGSDKGSLIKPL---------DSSSS------- 169

  Fly   195 VSQQSLVSVPAAALGNHLGWSDLTQWFKGHGSGHHKLTTTTTTPTSPPP---------PPQPATS 250
                          |.|....||:.....|...|.:.     .|..|||         .|.....
  Fly   170 --------------GAHRSDQDLSPTLPIHLPRHQQF-----LPRPPPPSKRGRRRKTSPSNDVP 215

  Fly   251 ALSVFTGGPGGGGSQP----DADYSFLISLHPYIKEMNGKQNRKFRQKVVGLIDDI 302
            .|:.:........::|    |:|.|||:|:.|::|.::...|.|||.::..::.::
  Fly   216 LLNGYASQASKSTTEPDLKNDSDLSFLMSMMPHVKSLSAISNLKFRMEMARVLVEL 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4404NP_572838.2 MADF 17..103 CDD:214738 18/85 (21%)
BESS 267..301 CDD:281011 12/33 (36%)
CG11723NP_001259906.1 MADF 7..91 CDD:214738 20/94 (21%)
BESS 236..270 CDD:281011 12/33 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438506
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12243
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.