DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4404 and madf-9

DIOPT Version :9

Sequence 1:NP_572838.2 Gene:CG4404 / 32241 FlyBaseID:FBgn0030432 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_500389.2 Gene:madf-9 / 191167 WormBaseID:WBGene00022608 Length:333 Species:Caenorhabditis elegans


Alignment Length:264 Identity:55/264 - (20%)
Similarity:101/264 - (38%) Gaps:70/264 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 MARKDDPVFNVRFVQFVENQPCLWNYTHPGYSKKEDVQRAWQQVANDIKDTVRNCRERWRTIRSS 70
            |..::.||||:|.:..|:.:|.|::.:..||:.......||.::|.:::.|..:.:.||:|:|..
 Worm    41 MKIEETPVFNIRLIAEVKARPFLYDQSDEGYNLLSWRNSAWNEIAENLETTSEHVKTRWKTLRDR 105

  Fly    71 FLRSLKLARTQTGRGKRKYYLSKYLQFLVPFTKSRSCHKQLPGMVLRKPGQAATAQQEDEVVAAE 135
            :.:..|  :.:..:....:...:.|:|:....|.|...:             ..:.|.:..|..|
 Worm   106 YKKEEK--KERVSKKASSWVFQRPLKFIQAHLKDRHTDE-------------TDSNQSEPAVKPE 155

  Fly   136 EEAKVSDGEMPLDVQVS--EEEHRRNQEQDREQPTACLPLRLHSIKVEHDSSNANQQLERMVSQQ 198
            ....||    |::..:|  |.|..|.|:..:                   ||.:..::|    ..
 Worm   156 PNGHVS----PMEAAMSFIENELIRTQDSSK-------------------SSGSTGEME----SS 193

  Fly   199 SLVSVPAAALGNHLGWSDLTQWFKGHGSGHHKLTTTTTTPTSPPPPPQP--------ATSALSVF 255
            |..:..:|:...:.|..:         .|...:.|       |||.|.|        |||:.|  
 Worm   194 SASTASSASSSKNTGTQE---------GGEASVIT-------PPPLPIPMAVTPSPSATSSAS-- 240

  Fly   256 TGGP 259
            .|||
 Worm   241 NGGP 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4404NP_572838.2 MADF 17..103 CDD:214738 17/85 (20%)
BESS 267..301 CDD:281011
madf-9NP_500389.2 MADF 52..136 CDD:214738 17/85 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156207
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12243
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.