DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4404 and madf-10

DIOPT Version :9

Sequence 1:NP_572838.2 Gene:CG4404 / 32241 FlyBaseID:FBgn0030432 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_492729.1 Gene:madf-10 / 190925 WormBaseID:WBGene00013717 Length:234 Species:Caenorhabditis elegans


Alignment Length:217 Identity:48/217 - (22%)
Similarity:84/217 - (38%) Gaps:58/217 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 NVRFV--QFVENQPCLWNYTHPGYSK-------KEDVQRAWQQVANDIKDTVRNCRERWRTIRSS 70
            :|||.  :.:.::|.||:.|....|.       .|.|:...||.......|:....:.|:.::.:
 Worm    48 SVRFAMCEAIAHRPGLWDSTREKVSSAARKNLFAEVVEVINQQFVLSPPLTIEEIEKHWKNLKDT 112

  Fly    71 FLRS-LKLARTQTG---RGKRKYYLSKYLQFLVPFTKSRSCHKQLPGMVLRKPGQAATAQQEDEV 131
            :::: .||.....|   |.|.|::.|  |.||....::....|:.|   ::..||.....|.   
 Worm   113 YVKTRRKLTFDHDGCPIRPKWKFFDS--LMFLDSVNQNDFVMKKRP---MQFQGQPYDLYQG--- 169

  Fly   132 VAAEEEAKVSDGEMPLDVQVSEEEHRRNQEQDREQPTAC----LPL-------RLHSIKVEHDSS 185
             .:.::.|:.  |||.|                |....|    |||       |:|.:|::    
 Worm   170 -PSSKKEKLE--EMPSD----------------EYMEFCRSLYLPLKEIGYKDRIHWLKIQ---- 211

  Fly   186 NANQQLERMVSQQSLVSVPAAA 207
               :.:..:|.:..|.||..||
 Worm   212 ---KSIRDIVYEAQLESVTKAA 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4404NP_572838.2 MADF 17..103 CDD:214738 23/98 (23%)
BESS 267..301 CDD:281011
madf-10NP_492729.1 MADF 53..147 CDD:214738 21/95 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156203
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001895
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.