DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4404 and madf-5

DIOPT Version :9

Sequence 1:NP_572838.2 Gene:CG4404 / 32241 FlyBaseID:FBgn0030432 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_497028.1 Gene:madf-5 / 175118 WormBaseID:WBGene00007242 Length:423 Species:Caenorhabditis elegans


Alignment Length:405 Identity:84/405 - (20%)
Similarity:138/405 - (34%) Gaps:125/405 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 PVFNVRFVQFVENQPCLWNYTHPGYSKKEDVQRAWQQVANDIKDTVRNC-----RERWRTIRSSF 71
            |.||.|.:..|...|||:|::..|.....:.||.|:.:|.:|..   ||     ::||..:|..:
 Worm     5 PAFNARLINEVRKYPCLYNHSRRGSGDTMERQRLWESIAKNIDP---NCAAEFAKKRWLQLRDRY 66

  Fly    72 LRSLKLARTQTGRGKRKYYLSKYLQFLVPFTKSRSCHKQLPGMVLRKPGQ--------------- 121
            .:.||:|.........::.....|.:|.||.|.........|   :|.|:               
 Worm    67 RKELKIAIKNGFVTPVRWCYFNQLSWLDPFLKDNIGQAADEG---KKTGKSDSFDEPSGTPFSWF 128

  Fly   122 ------------------------------AATAQQEDEV---VAAEEEAKVS----------DG 143
                                          |.|||:.|.:   :..:|....|          ||
 Worm   129 GFPNLNSIKDEMEDDDSDPALESSVLDRLLAQTAQRLDSISPEIENDESGTQSLDGNLDGVDGDG 193

  Fly   144 EMPLDVQVSEEE--HRRNQEQDREQPTACLPLRLHSIKVEHDSSNANQQLERMVSQ-------QS 199
            :...|:::.:|:  .....|:.:.|..|...|: .:|..:........|..:.|.|       :|
 Worm   194 DEEEDLKIKDEDEVEEDGPEKVKSQSEAMAMLK-EAISAQSQQQTQQAQQVQQVQQTPQKPSVES 257

  Fly   200 LVSVPAAALGNHL-----GWSDLTQWFKGHGSGHHKLTTTTTTPTSP--PPPPQPATSALSVFTG 257
            |::...|...:||     |.|.:.       :|..|.......|..|  |||....||....:..
 Worm   258 LIAANQARFAHHLAAQLTGMSSML-------NGARKSEEAAIPPLRPSTPPPTASTTSHFHPYKE 315

  Fly   258 GPGGGGSQPDAD------------------------YSFLISLHPYIKEMNGKQNRKFRQKVVGL 298
            .......|..||                        ||.:|.|.  :|:|:.|:.:|.|.:::.|
 Worm   316 AARNRHRQQTADNVMRYHLQQVGRVALEWLNDEDLLYSRIIGLK--LKKMDPKKRKKVRHQIMSL 378

  Fly   299 IDD------ILDNKD 307
            :|:      |:||.|
 Worm   379 LDETDDTHHIVDNDD 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4404NP_572838.2 MADF 17..103 CDD:214738 24/90 (27%)
BESS 267..301 CDD:281011 12/57 (21%)
madf-5NP_497028.1 MADF 10..98 CDD:214738 24/90 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 50 1.000 Inparanoid score I4107
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12243
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R17076
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.090

Return to query results.
Submit another query.