DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4404 and madf-2

DIOPT Version :9

Sequence 1:NP_572838.2 Gene:CG4404 / 32241 FlyBaseID:FBgn0030432 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_492896.1 Gene:madf-2 / 173019 WormBaseID:WBGene00009461 Length:290 Species:Caenorhabditis elegans


Alignment Length:279 Identity:47/279 - (16%)
Similarity:97/279 - (34%) Gaps:95/279 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 MARKDDPVFNVRFVQFVENQPCLWNYTHPGYSKKEDVQRA-WQQVAND--------IKDTVRNCR 61
            ||:..||.... .:..:.|:|.:|:..:.|.|....::.: .::|.::        ||.|..:.|
 Worm     1 MAQWTDPSRQC-LINAIRNRPVIWDKNYFGESNYRTLKTSCLREVTSELNSMFQMPIKFTCEDVR 64

  Fly    62 ERWRTIRSSFLRSLKLARTQTGRGKR----------KYYLSKYLQF------------------L 98
            .:|:.::.:|:|.|:...    .||.          |:|  :.|.|                  |
 Worm    65 SQWKNLKDTFVRKLRWVH----EGKYMEDAMKEPTWKFY--RMLTFLDEKEAKRLGDTCEHTYEL 123

  Fly    99 VPFTKSRSCHK-------------------------QLPGMVLRKPGQAATAQQEDEVVAA---- 134
            .|  .|.||.:                         ||....:....|.||...|.::.::    
 Worm   124 AP--NSTSCGQRAQISYEPTSTEEKMFQMFNNQPPPQLSQQSMIDSSQIATCSNEPKMTSSSTFV 186

  Fly   135 ------EEEAKVSDGEMP------LDVQVSEEEHRRNQEQD-REQPTACLPLRL-------HSIK 179
                  :.....|....|      |:.::.:|:.:..:::. |.|.:...|:::       |..:
 Worm   187 TSSTSLKRGVHYSPTRSPNGSSSGLEEELEDEDEQPGRKKSCRRQVSNIQPMQVITTPPVAHQDE 251

  Fly   180 VEHDSSNANQQLERMVSQQ 198
            .:|..:.....|.|:.::|
 Worm   252 FDHFGAMVAANLRRIANEQ 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4404NP_572838.2 MADF 17..103 CDD:214738 22/122 (18%)
BESS 267..301 CDD:281011
madf-2NP_492896.1 MADF 11..107 CDD:214738 20/102 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156199
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001895
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.