DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4404 and si:ch73-59f11.3

DIOPT Version :9

Sequence 1:NP_572838.2 Gene:CG4404 / 32241 FlyBaseID:FBgn0030432 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001315046.1 Gene:si:ch73-59f11.3 / 107988036 ZFINID:ZDB-GENE-131121-446 Length:180 Species:Danio rerio


Alignment Length:245 Identity:47/245 - (19%)
Similarity:85/245 - (34%) Gaps:83/245 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 RFVQFVENQPCLWNYTHPGYSKKEDVQRAWQQVANDIK-DTVRNCRERWRTIRSSFLRSLK-LAR 79
            |..:.|:..|.|::::...:...|.|..:|:::|..:. |....|:..||.||..|.:::| :.|
Zfish     7 RVAELVKLYPHLYDHSLRDFKVPEKVFNSWKEIATKLGIDNPETCKSTWRNIRDKFSKAMKRMLR 71

  Fly    80 TQTGRGKRKYYLSKYLQFLVPFTKSRSCHKQLPGMVLRKPGQAATAQQEDEVVAAEEEAKVSDGE 144
            .......|...|...|::|.||.:.|:                               ..|||..
Zfish    72 KGGDEDARVPRLFVELKWLRPFVRLRA-------------------------------NTVSDTP 105

  Fly   145 MPLDVQVSEEEHRRNQEQDREQPTACLPLRLHSIKVEHDSSNAN-----QQLERMVSQQSLVSVP 204
            . .:.::..||..:|.                   |..:||:::     ..:|...|..||.:..
Zfish   106 C-FEFEIQNEETPKNM-------------------VAEESSSSSGCTNESDVEGRCSAASLDAFG 150

  Fly   205 AAALGNHLGWSDLTQWFKGHGSGHHKLTTT-----TTTPTSPPPPPQPAT 249
            .:||                    |:|::|     |:|...|.|...|::
Zfish   151 TSAL--------------------HRLSSTPCEAVTSTIAQPSPSSAPSS 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4404NP_572838.2 MADF 17..103 CDD:214738 23/87 (26%)
BESS 267..301 CDD:281011
si:ch73-59f11.3NP_001315046.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.