DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Flad1 and yfaY

DIOPT Version :10

Sequence 1:NP_572837.1 Gene:Flad1 / 32240 FlyBaseID:FBgn0030431 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_416752.1 Gene:yfaY / 945478 ECOCYCID:G7162 Length:400 Species:Escherichia coli


Alignment Length:84 Identity:20/84 - (23%)
Similarity:34/84 - (40%) Gaps:27/84 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 EDRLA-----IEERQNKAFAFFAETLQIYGVEELIFCF---NG------------------GKDC 129
            |:.||     |.||:...||..|..:..:..|.|.|..   :|                  .:.|
E. coli   302 EETLAQTAHWITERRANHFAGLALAVSGFENEHLNFALATPDGTFALRVRFSTTRYSLAIRQEVC 366

  Fly   130 TVL-LDLLMRYLRQENISS 147
            .:: |::|.|:|..::|:|
E. coli   367 AMMALNMLRRWLNGQDIAS 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Flad1NP_572837.1 FAD_synthase 99..276 CDD:467513 15/71 (21%)
yfaYNP_416752.1 PRK03673 1..396 CDD:179629 20/84 (24%)

Return to query results.
Submit another query.