DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4407 and MET16

DIOPT Version :9

Sequence 1:NP_572837.1 Gene:CG4407 / 32240 FlyBaseID:FBgn0030431 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_015493.1 Gene:MET16 / 856296 SGDID:S000006371 Length:261 Species:Saccharomyces cerevisiae


Alignment Length:211 Identity:52/211 - (24%)
Similarity:81/211 - (38%) Gaps:54/211 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 PMELTAEDRLAIEERQNKAFAFFAETLQIYGVEELIFCFNGGKDCTVLLDLLMRYLRQENISSGD 149
            |..||.::.:..:..|.|     .:|:.:|..:          .|....|...:|        ||
Yeast    83 PQTLTLKNEIEKKYYQPK-----NQTIHVYKPD----------GCESEADFASKY--------GD 124

  Fly   150 IPMLYIKSGDSFPEIDEFVERCVRNYRVQLVQYEGTLKEALTHMSSDMPRIKAVFVGSRNTDPYC 214
              .|:.|..|.:..:.: ||...|.|           ||.         .|.|||.|.|.:....
Yeast   125 --FLWEKDDDKYDYLAK-VEPAHRAY-----------KEL---------HISAVFTGRRKSQGSA 166

  Fly   215 QHLAPMQPTDNDWPPMMRLNPLLEWSYHDVWHYIHLNSVPYCSLYDRGYTSIGNRANTVP----- 274
            :....:...| :...::::|||:.|::..|..||..|:|||..|.|.||.|||:..:|.|     
Yeast   167 RSQLSIIEID-ELNGILKINPLINWTFEQVKQYIDANNVPYNELLDLGYRSIGDYHSTQPVKEGE 230

  Fly   275 --NPHLRRTDAECECG 288
              .....:..|:.|||
Yeast   231 DERAGRWKGKAKTECG 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4407NP_572837.1 PAPS_reductase 118..267 CDD:238846 37/148 (25%)
MET16NP_015493.1 PAPS_reductase 17..248 CDD:131112 52/211 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 52 1.000 Domainoid score I2838
eggNOG 1 0.900 - - E1_COG0175
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.