DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4407 and FPY1

DIOPT Version :9

Sequence 1:NP_572837.1 Gene:CG4407 / 32240 FlyBaseID:FBgn0030431 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_013903.1 Gene:FPY1 / 855216 SGDID:S000004790 Length:274 Species:Saccharomyces cerevisiae


Alignment Length:175 Identity:36/175 - (20%)
Similarity:58/175 - (33%) Gaps:65/175 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 FFAETLQIYGVEELIFCFNG----------GKDCTVLLDLLMRYLRQEN--ISSGDIPMLYIKSG 158
            |||:           :||:.          |.|.|.::|.:.|.::..:  ||:|.|.       
Yeast    27 FFAK-----------YCFDHGIQLKEIATIGDDETQIVDTVRRLVKNYDFIISTGGIG------- 73

  Fly   159 DSFPEIDEFVERCVRNYRVQLVQYEGTLKEALTHMSSDMPRIKAVFVGSRNTDPYCQH--LAPMQ 221
               |..|:....|:........:.:...||.:.|.|....|:.|        |....|  :|.|.
Yeast    74 ---PTHDDITYECMAKSFNLPCELDEECKERMRHKSDPEARLDA--------DALKAHYQMATMP 127

  Fly   222 PTDNDWPPMMRLNPLLEWSYH---DVWHYIHLNSVPYCSLYDRGY 263
            ...|            ..:|:   |:|       ||.||:..:.|
Yeast   128 KGTN------------VKNYYVCDDLW-------VPICSISHKMY 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4407NP_572837.1 PAPS_reductase 118..267 CDD:238846 33/163 (20%)
FPY1NP_013903.1 CinA 3..265 CDD:223986 36/175 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0175
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2605
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002779
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2358
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.790

Return to query results.
Submit another query.