DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4407 and APR2

DIOPT Version :9

Sequence 1:NP_572837.1 Gene:CG4407 / 32240 FlyBaseID:FBgn0030431 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_176409.1 Gene:APR2 / 842514 AraportID:AT1G62180 Length:454 Species:Arabidopsis thaliana


Alignment Length:318 Identity:71/318 - (22%)
Similarity:120/318 - (37%) Gaps:86/318 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 RPRLPQ---TLRPLSTMNECRKNITNITNITANNSILCAKSISKKHLFLEKRSMSDRSENSKDVA 77
            |..|.|   :::||:..:..|..     :.....|.|.|..:.:|         ....|:.:.:|
plant    39 RTHLSQRRYSMKPLNAESHSRSE-----SWVTRASTLIAPEVEEK---------GGEVEDFEQLA 89

  Fly    78 KGQDISNPMELTAEDRLAIEERQNKAFAFFAETLQIYGVEELIFCFNGGKDCTVL--LDLLMRYL 140
            |..:.::|:|:           .:||...|.:.:.|        .|:|.:|..::  ..|..:..
plant    90 KKLEDASPLEI-----------MDKALERFGDQIAI--------AFSGAEDVALIEYARLTGKPF 135

  Fly   141 RQENISSGDI-PMLY-----------IKSGDSFPEIDEFVERCVRN--------------YRVQL 179
            |..::.:|.: |..|           |:....||:..| |:..|||              .||:.
plant   136 RVFSLDTGRLNPETYRLFDAVEKQYGIRIEYMFPDAVE-VQALVRNKGLFSFYEDGHQECCRVRK 199

  Fly   180 VQ-----YEGTLKEALTHMSSDMPRIKAVFVGSRNTDPYCQHLAPMQPTDNDWPPMMRLNPLLEW 239
            |:     .:| ||..:|....|..      .|:|:..|..|.....:..|.....:::.|||...
plant   200 VRPLRRALKG-LKAWITGQRKDQS------PGTRSEIPIVQVDPVFEGLDGGVGSLVKWNPLANV 257

  Fly   240 SYHDVWHYIHLNSVPYCSLYDRGYTSIGNRANT---VPNPHLRR-----TDAEC-ECG 288
            ...|||:::....||..:|:.:||.|||....|   :|..|.|.     .||:. |||
plant   258 EGADVWNFLRTMDVPVNALHAQGYVSIGCEPCTRPVLPGQHEREGRWWWEDAKAKECG 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4407NP_572837.1 PAPS_reductase 118..267 CDD:238846 41/181 (23%)
APR2NP_176409.1 APS_reduc 1..454 CDD:273072 71/318 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0175
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 40 1.000 Inparanoid score I2699
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.