DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4407 and AT5G03430

DIOPT Version :9

Sequence 1:NP_572837.1 Gene:CG4407 / 32240 FlyBaseID:FBgn0030431 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_568117.1 Gene:AT5G03430 / 831843 AraportID:AT5G03430 Length:497 Species:Arabidopsis thaliana


Alignment Length:239 Identity:86/239 - (35%)
Similarity:126/239 - (52%) Gaps:23/239 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 DRLAIEERQNKAFAFFAETLQIYGVEELIFCFNGGKDCTVLLDLL----MRYLRQENISSGDI-- 150
            |...::.:.|.|.......|.:|.:||:.|.||||||.||||.||    ..:.:::..|:|.:  
plant    11 DDKRLKTKYNNAIFVIKRALALYSIEEVAFSFNGGKDSTVLLHLLRAGYFLHKKEQTCSNGGLSS 75

  Fly   151 -PM--LYIKSGDSFPEIDEFVERCVRNYRVQLVQYEGTLKEALTHMSSDMPRIKAVFVGSRNTDP 212
             |:  :|.:|..:|.||:.|.....:.|.:||.......|..|..:....| |:|:|:|.|..||
plant    76 FPVRTIYFESPSAFTEINAFTYDAAQTYNLQLDIIRQDFKSGLEALLKANP-IRAIFLGVRIGDP 139

  Fly   213 YCQHLAPMQPTDNDWPPMMRLNPLLEWSYHDVWHYIHLNSVPYCSLYDRGYTSIGNRANTVPNPH 277
            .........|:...|||.||:||:|:|||.|||.::....|.||||||:||||||:..:||||..
plant   140 TAVGQEQFSPSSPGWPPFMRVNPILDWSYRDVWAFLLTCKVKYCSLYDQGYTSIGSIHDTVPNSL 204

  Fly   278 LRRTDAECECGSNSDAVCSCDLGGYRPAWELQDATMERAGRLPR 321
            |...|.     |:.:.        ::||:.|.|..:|||||:.:
plant   205 LSVNDT-----SSKEK--------FKPAYLLSDGRLERAGRVKK 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4407NP_572837.1 PAPS_reductase 118..267 CDD:238846 62/157 (39%)
AT5G03430NP_568117.1 PAPS_reductase 37..194 CDD:238846 62/157 (39%)
cinA 255..408 CDD:238450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0175
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002779
OrthoInspector 1 1.000 - - otm3336
orthoMCL 1 0.900 - - OOG6_102300
Panther 1 1.100 - - LDO PTHR23293
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3137
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.770

Return to query results.
Submit another query.