DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4407 and APR3

DIOPT Version :9

Sequence 1:NP_572837.1 Gene:CG4407 / 32240 FlyBaseID:FBgn0030431 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_193930.1 Gene:APR3 / 828288 AraportID:AT4G21990 Length:458 Species:Arabidopsis thaliana


Alignment Length:342 Identity:77/342 - (22%)
Similarity:142/342 - (41%) Gaps:59/342 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VTSSFLLARARPRLPQTLRPLSTMNECRKNITNITNITANNSILCAKSISKKHLFLEKRSMSDRS 70
            |:||...|.:....|.:...::.:...|  :.|.||::|.:..|..|..|.|.|.::  |::..|
plant     7 VSSSSSSAISSSSFPSSDLKVTKIGSLR--LLNRTNVSAASLSLSGKRSSVKALNVQ--SITKES 67

  Fly    71 ENSKDVAKGQDISNPMELTAEDRLAIEERQNKAFAFFAETLQIYGVEELIFCFNGGKDCTVL--L 133
            ..:.:|.:..|:   :|:...:.||.............:.|:.:| .::...|:|.:|..::  .
plant    68 IVASEVTEKLDV---VEVEDFEELAKRLENASPLEIMDKALEKFG-NDIAIAFSGAEDVALIEYA 128

  Fly   134 DLLMRYLRQENISSGDI-PMLY-----------IKSGDSFPEIDEFVERCVRN------------ 174
            .|..|..|..::.:|.: |..|           |:....||:..| |:..|||            
plant   129 HLTGRPYRVFSLDTGRLNPETYRLFDTVEKHYGIRIEYMFPDAVE-VQALVRNKGLFSFYEDGHQ 192

  Fly   175 --YRVQLVQYEGTLKEALTHMSSDMP-RIKAVFVGSRNTDPYCQHLAPMQPTDNDWPPMMRLNPL 236
              .|::.|:   .|:.||..:.:.:. :.|....|:|:..|..|.....:..|.....:::.||:
plant   193 ECCRIRKVR---PLRRALKGLRAWITGQRKDQSPGTRSEIPVVQVDPVFEGLDGGVGSLVKWNPV 254

  Fly   237 LEWSYHDVWHYIHLNSVPYCSLYDRGYTSIG----NRANTVPNPHLRR-----TDAEC-ECG--- 288
            .....:|||:::....||..:|:..||.|||    .|| .:|..|.|.     .||:. |||   
plant   255 ANVEGNDVWNFLRTMDVPVNTLHAAGYVSIGCEPCTRA-VLPGQHEREGRWWWEDAKAKECGLHK 318

  Fly   289 ----SNSDAVCSCDLGG 301
                .|::...:.::.|
plant   319 GNIKENTNGNATANVNG 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4407NP_572837.1 PAPS_reductase 118..267 CDD:238846 39/177 (22%)
APR3NP_193930.1 PLN02309 24..458 CDD:215175 72/325 (22%)
PRK02090 83..322 CDD:234997 55/244 (23%)
PDI_a_APS_reductase 346..454 CDD:239291
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0175
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 40 1.000 Inparanoid score I2699
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.