DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4407 and APR1

DIOPT Version :9

Sequence 1:NP_572837.1 Gene:CG4407 / 32240 FlyBaseID:FBgn0030431 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_192370.1 Gene:APR1 / 825793 AraportID:AT4G04610 Length:465 Species:Arabidopsis thaliana


Alignment Length:341 Identity:65/341 - (19%)
Similarity:121/341 - (35%) Gaps:115/341 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 TSSFLLARARPRLPQTLRPLSTMNECRKNITNITNITANNSILCAKSISKKHLFLEKRSMSDRSE 71
            :||.....|.|:...::.||:.        |.:..|.....::                   ..|
plant    54 SSSVKPLNAEPKTKDSMIPLAA--------TMVAEIAEEVEVV-------------------EIE 91

  Fly    72 NSKDVAKGQDISNPMELTAEDRLAIEERQNKAFAFFAETLQIYGVEELIFCFNGGKDCTVLLDLL 136
            :.:::||..:.::|:|:           .:||       |:.|| .::...|:|.:|..     |
plant    92 DFEELAKKLENASPLEI-----------MDKA-------LEKYG-NDIAIAFSGAEDVA-----L 132

  Fly   137 MRYLRQENISSGDIPMLYIKSGDSFPEIDEFVERCVRNYRVQL-------VQYEGTLK-EALTHM 193
            :.|   .:::.....:..:.:|...||...|.:...::|.:::       |:.:|.:: :.|...
plant   133 IEY---AHLTGRPFRVFSLDTGRLNPETYRFFDAVEKHYGIRIEYMFPDSVEVQGLVRSKGLFSF 194

  Fly   194 SSD-----------------MPRIKAVFVGSR--------------NTDPYCQHLAPMQPTDNDW 227
            ..|                 :..:||...|.|              ..||..:.|      |...
plant   195 YEDGHQECCRVRKVRPLRRALKGLKAWITGQRKDQSPGTRSEIPVVQVDPVFEGL------DGGV 253

  Fly   228 PPMMRLNPLLEWSYHDVWHYIHLNSVPYCSLYDRGYTSIGNRANT---VPNPHLRR-----TDAE 284
            ..:::.||:.....:|||:::....||..:|:..||.|||....|   :|..|.|.     .||:
plant   254 GSLVKWNPVANVEGNDVWNFLRTMDVPVNTLHAAGYISIGCEPCTKAVLPGQHEREGRWWWEDAK 318

  Fly   285 C-ECG-------SNSD 292
            . |||       .|||
plant   319 AKECGLHKGNVKENSD 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4407NP_572837.1 PAPS_reductase 118..267 CDD:238846 33/187 (18%)
APR1NP_192370.1 APS_reduc 1..465 CDD:273072 65/341 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0175
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 40 1.000 Inparanoid score I2699
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.