DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4407 and FLAD1

DIOPT Version :9

Sequence 1:NP_572837.1 Gene:CG4407 / 32240 FlyBaseID:FBgn0030431 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_079483.3 Gene:FLAD1 / 80308 HGNCID:24671 Length:587 Species:Homo sapiens


Alignment Length:236 Identity:92/236 - (38%)
Similarity:139/236 - (58%) Gaps:26/236 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 AEDRLAIEERQNKAFAFFAETLQIYGVEELIFCFNGGKDCTVLLDLLMRYLRQENISSGDIP--- 151
            ||...::.::...|......:|..|.:.:|...||||||||.||.|....::::   ..|:|   
Human   370 AESGSSLGKKVAGALQTIETSLAQYSLTQLCVGFNGGKDCTALLHLFHAAVQRK---LPDVPNPL 431

  Fly   152 -MLYIKSGDSFPEIDEFVERCVRNYRVQLVQYEGTLKEALTHMSSDMPRIKAVFVGSRNTDPYCQ 215
             :|||:|...|||:::|::..::.|.:|:::.||::|:||..:.:..|:::||.:|:|.||||..
Human   432 QILYIRSISPFPELEQFLQDTIKRYNLQMLEAEGSMKQALGELQARHPQLEAVLMGTRRTDPYSC 496

  Fly   216 HLAPMQPTDNDWPPMMRLNPLLEWSYHDVWHYIHLNSVPYCSLYDRGYTSIGNRANTVPNPHLRR 280
            .|.|..|||..||..||:||||:|:|.|:|.::....||||.||||||||:|:|.|||.||.|: 
Human   497 SLCPFSPTDPGWPAFMRINPLLDWTYRDIWDFLRQLFVPYCILYDRGYTSLGSRENTVRNPALK- 560

  Fly   281 TDAECECGSNSDAVCSCDLGG---YRPAWELQDATMERAGR 318
                  |.|.         ||   ||||:.|::...||..|
Human   561 ------CLSP---------GGHPTYRPAYLLENEEEERNSR 586

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4407NP_572837.1 PAPS_reductase 118..267 CDD:238846 67/152 (44%)
FLAD1NP_079483.3 CinA 110..346 CDD:223986
cinA 112..266 CDD:238450
Molybdenum cofactor biosynthesis protein-like 114..205
FAD synthase 398..555 71/159 (45%)
PAPS_reductase 398..548 CDD:238846 67/152 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143851
Domainoid 1 1.000 51 1.000 Domainoid score I11652
eggNOG 1 0.900 - - E1_COG0175
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H115598
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2605
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1437247at2759
OrthoFinder 1 1.000 - - FOG0002779
OrthoInspector 1 1.000 - - otm42062
orthoMCL 1 0.900 - - OOG6_102300
Panther 1 1.100 - - LDO PTHR23293
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2358
SonicParanoid 1 1.000 - - X3137
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.690

Return to query results.
Submit another query.