DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment HOXC8 and ftz

DIOPT Version :9

Sequence 1:	NP_073149.1	Gene:	HOXC8 / 3224	HGNCID:	5129	Length:	242	Species:	Homo sapiens
Sequence 2:	NP_477498.1	Gene:	ftz / 40834	FlyBaseID:	FBgn0001077	Length:	410	Species:	Drosophila melanogaster

Alignment Length:	102	Identity:	48/102 - (47%)
Similarity:	58/102 - (56%)	Gaps:	32/102 - (31%)

- Green bases have known domain annotations that are detailed below.

Human   113 DCKSSANTNSSEGQGHLNQNSSPSLMFPWMRPHAPGRRSGRQTYSRYQTLELEKEFLFNPYLTRK 177
            |||.|..|                                ||||:|||||||||||.||.|:||:
  Fly   250 DCKDSKRT--------------------------------RQTYTRYQTLELEKEFHFNRYITRR 282

Human   178 RRIEVSHALGLTERQVKIWFQNRRMKWKKENNKDKLP 214
            |||::::||.|:|||:||||||||||.||:...|..|
  Fly   283 RRIDIANALSLSERQIKIWFQNRRMKSKKDRTLDSSP 319

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
HOXC8	NP_073149.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	114..154		4/39 (10%)
		Antp-type hexapeptide	138..143		0/4 (0%)
		Homeobox	153..205	CDD:306543	39/51 (76%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	206..242		3/9 (33%)
ftz	NP_477498.1	FTZ	1..248	CDD:281812
ftz	NP_477498.1	Homeobox	257..310	CDD:278475	40/84 (48%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E2759_KOG0489
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	1	1.000	-	-		FOG0000007
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	3	2.810