DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Coq8 and ubiB

DIOPT Version :9

Sequence 1:NP_572836.1 Gene:Coq8 / 32239 FlyBaseID:FBgn0052649 Length:661 Species:Drosophila melanogaster
Sequence 2:NP_418279.1 Gene:ubiB / 948322 ECOCYCID:EG11476 Length:546 Species:Escherichia coli


Alignment Length:290 Identity:74/290 - (25%)
Similarity:127/290 - (43%) Gaps:29/290 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   279 ERIVDTLCKVRGAALKIGQILSIQDSSV---VSPQLAKAFERVRQAADYMPDWQVERVMNTQLGA 340
            ||:...|.::....:|.||:||.:....   ::.|||...::|......:...|:|..|......
E. coli    55 ERLRLALQELGPVWIKFGQMLSTRRDLFPPHIADQLALLQDKVAPFDGKLAKQQIEAAMGGLPVE 119

  Fly   341 DWRQRLKSFEDKPFAAASIGQVHRATL-SDGMDVAIKIQYPGVAQSIESDIDNLVGMLKVW--DV 402
            .|   ...||.||.|:|||.|||.|.| |:|.:|.||:..|.:...|::|: .|:..|..|  .:
E. coli   120 AW---FDDFEIKPLASASIAQVHTARLKSNGKEVVIKVIRPDILPVIKADL-KLIYRLARWVPRL 180

  Fly   403 FPQGFFI--DNVVRVAKRELQWEVDYDREAEYTEKFREMIAPYPEYYVPRVVRDLTTSSVLTTEL 465
            .|.|..:  ..|||..::.|..|::..||:....:.|......|..|:|.|..|..:..::..|.
E. coli   181 LPDGRRLRPTEVVREYEKTLIDELNLLRESANAIQLRRNFEDSPMLYIPEVYPDYCSEGMMVMER 245

  Fly   466 VPGVPLD--KCFDLSYEHRRHIAASVLKLCLRELFEIECMQTDPNWSNFL--YDAPSR-RLMLID 525
            :.|:|:.  ...:.:..:.:.:|...:::...::|.......|.:..|..  |:.|.. :.:.||
E. coli   246 IYGIPVSDVAALEKNGTNMKLLAERGVQVFFTQVFRDSFFHADMHPGNIFVSYEHPENPKYIGID 310

  Fly   526 FG--------STRFYRHEFI----RNYRRV 543
            .|        ..|:....||    |:||:|
E. coli   311 CGIVGSLNKEDKRYLAENFIAFFNRDYRKV 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Coq8NP_572836.1 AarF 262..641 CDD:223733 74/290 (26%)
ABC1_ADCK3 313..563 CDD:270872 63/253 (25%)
ubiBNP_418279.1 ubiB 3..545 CDD:235310 74/290 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0661
Hieranoid 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
32.810

Return to query results.
Submit another query.