DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Coq8 and MCP2

DIOPT Version :9

Sequence 1:NP_572836.1 Gene:Coq8 / 32239 FlyBaseID:FBgn0052649 Length:661 Species:Drosophila melanogaster
Sequence 2:NP_013354.1 Gene:MCP2 / 850955 SGDID:S000004243 Length:569 Species:Saccharomyces cerevisiae


Alignment Length:410 Identity:93/410 - (22%)
Similarity:164/410 - (40%) Gaps:61/410 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   269 REALLSPANAERIVDTLCKVR---GAALKIGQILSIQDSSVVSPQLAKAF-ERVRQAADYMPD-- 327
            ||..|:..:....:.||..:|   |..:|:||.:     ..::..|.|.: :.:....|:.|:  
Yeast    97 REVALNKCHKMCALITLHALRSNGGIYIKLGQHI-----GAMTYLLPKEWTDTMIPLQDHCPEST 156

  Fly   328 -WQVERVMNTQLGADWRQRLKSFEDKPFAAASIGQVHRATLSD----GMDVAIKIQYPGVAQSIE 387
             .:::.:....||.........|...|...||:.|||.|.|.:    |..||:|.|:|.:.:.|.
Yeast   157 YEEIDELFKEDLGTSIEDMFLEFNKTPIGVASLAQVHVAKLKNSDGKGSSVAVKCQHPSLKEFIP 221

  Fly   388 SDIDNLVGMLKVWDVFPQGFFIDNVVRVAKRELQ----WEVDYDREAEYTEKFREMIAPYPE--- 445
            .|:.....:.::.||    ||.|..:.....|||    .|:::.:|||..||.|...:.:.:   
Yeast   222 LDVMLTRTVFELLDV----FFPDYPLTWLGDELQSSIYVELNFTKEAENAEKTRHYFSKFKKQTA 282

  Fly   446 YYVPRVVRDLTTSSVLTTELVPGVPLDKCFDLSYEHRRHIAASVLKLCLRELFE---------IE 501
            ..:|:|:.  :...:|..|.|.|..||   ||.|.....|:.|.:..||..:|.         |.
Yeast   283 LKIPKVIE--SHKRILIMEYVGGKRLD---DLEYIDSHGISRSEVSSCLSHIFNNMIFTPNVGIH 342

  Fly   502 CMQTDPNWSNFLYDA--PSR-------RLMLIDFGSTRFYRHEFIRNYRRVIMSAAENNRQGVLE 557
            |   ||:..|....:  |::       .::|.|.|..|:......|.|.:..:|...:..|    
Yeast   343 C---DPHGGNLAIRSVKPAKDNGYHNFEIVLFDHGLYRYPSTRTRRLYAKFWLSLLFDKDQ---- 400

  Fly   558 MSREMGFLTGYETKQMEQAHVDAVMILGEIFRYDGDFDFGRQNTTERLAALVPTMVAHRLCPPPE 622
             ::...:..|:.....||..:.|..|.|.......::|.....|.|.:..:...::...|.   .
Yeast   401 -TKMKKYAKGFANITDEQFPLLAAAITGRSIDAALNYDISTSRTQEEMDVMANGILEGTLL---S 461

  Fly   623 EIYSIHRKLSGIFLLCARLN 642
            ::.||..::..:.||..:.|
Yeast   462 DLMSILSRIPRVVLLILKTN 481

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Coq8NP_572836.1 AarF 262..641 CDD:223733 92/407 (23%)
ABC1_ADCK3 313..563 CDD:270872 67/282 (24%)
MCP2NP_013354.1 AarF 47..569 CDD:223733 93/410 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0661
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.