DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Coq8 and AT1G79600

DIOPT Version :9

Sequence 1:NP_572836.1 Gene:Coq8 / 32239 FlyBaseID:FBgn0052649 Length:661 Species:Drosophila melanogaster
Sequence 2:NP_565214.1 Gene:AT1G79600 / 844298 AraportID:AT1G79600 Length:711 Species:Arabidopsis thaliana


Alignment Length:415 Identity:106/415 - (25%)
Similarity:180/415 - (43%) Gaps:64/415 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 LSRRN--------KDRSVSLRTPATKS-NQTMPKKE-TSTNPGIITQDTEYVNNVLRFVAGAKVE 198
            ||.||        |..||:.|..|..: .|..||:: .:.:|...::..    :|:::......:
plant    18 LSLRNSKINVGKSKFFSVNRRRLARAALVQARPKEDGAAASPSPSSRPA----SVVQYRRADLAD 78

  Fly   199 EQPPDAQPKKKSDQPAIEVPELSKVAKQRKVPSSRIGR----MASFGGLFAGLGL----GTLNE- 254
            :...:|:...::...:|..|||. ..|....|...:.|    :.:.||....||:    |.|.: 
plant    79 DLQAEARALGRAIDASIYSPELI-ARKHGSQPFKALRRSLEILGALGGFALKLGIDQKQGNLEKN 142

  Fly   255 LTKGALGLGGSTSMREALLSPANAERIVDTLCKVRGAALKIGQILSIQDSSVVSPQLAKAFERVR 319
            :.|.|:.|                .||   ..::....:|:||.||.: ..:..|...:....::
plant   143 MKKRAIEL----------------RRI---FTRLGPTFVKLGQGLSTR-PDLCPPDYLEELAELQ 187

  Fly   320 QAADYMPDWQVERVMNTQLGADWRQRLKSFEDKPFAAASIGQVHRATLS-DGMDVAIKIQYPGVA 383
            .|....||.:....:..:|.........|...:|.||||:|||::|.|. .|..||:|:|.||:.
plant   188 DALPTFPDAEAFACIERELDLSLETIFSSVSPEPIAAASLGQVYKAQLRYSGQVVAVKVQRPGIE 252

  Fly   384 QSIESDIDNLVGMLKVWDVFPQGFFIDNVVRV----AKRELQWEVDYDREAEYTEKFREMIAPYP 444
            ::|..|...:.|:.|:.:.:.. |...:|:.:    |.|..| |::|.:||:...:|:::.|...
plant   253 EAIGLDFYLIRGVGKLINKYVD-FITTDVLTLIDEFACRVYQ-ELNYVQEAQNARRFKKLYADKA 315

  Fly   445 EYYVPRVVRDLTTSSVLTTELVPGVPLDKCFDLSYEHRRHIAASVLKL------C-LRELFEIEC 502
            :..||.:..|.|:..|||.|.|.|..|::  .|:.|.:   ...||.|      | ||:|.|...
plant   316 DVLVPDIFWDYTSRKVLTMEWVEGTKLNE--QLAIESQ---GLKVLDLVNTGIQCSLRQLLEYGF 375

  Fly   503 MQTDPNWSNFLYDAPSRRLMLIDFG 527
            ...||:..|.| ..|..:|..:|||
plant   376 FHADPHPGNLL-ATPDGKLAFLDFG 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Coq8NP_572836.1 AarF 262..641 CDD:223733 76/278 (27%)
ABC1_ADCK3 313..563 CDD:270872 67/227 (30%)
AT1G79600NP_565214.1 AarF 101..606 CDD:223733 87/328 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0661
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.